Product Information
67365-1-PBS targets FBXO11 in WB, Indirect ELISA applications and shows reactivity with Human samples.
Tested Reactivity | Human |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag24401 Product name: Recombinant human FBXO11 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 858-927 aa of BC012728 Sequence: TDRNAICVNCIKKCHQGHDVEFIRHDRFFCDCGAGTLSNPCTLAGEPTHDTDTLYDSAPPIESNTLQHN Predict reactive species |
Full Name | F-box protein 11 |
Calculated Molecular Weight | 927 aa, 104 kDa |
Observed Molecular Weight | 94-104 kDa |
GenBank Accession Number | BC012728 |
Gene Symbol | FBXO11 |
Gene ID (NCBI) | 80204 |
RRID | AB_2882617 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein G purification |
UNIPROT ID | Q86XK2 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |