FBXO11 Monoclonal antibody, PBS Only

• 

  WB analysis using 67365-1-Ig (same clone as 67365-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67365-1-Ig (FBXO11 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67365-1-PBS in a different storage buffer formulation.

• 

  WB analysis of U2OS using 67365-1-Ig (same clone as 67365-1-PBS)

  U2OS cells were subjected to SDS PAGE followed by western blot with 67365-1-Ig (FBXO11 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67365-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 67365-1-Ig (same clone as 67365-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67365-1-Ig (FBXO11 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67365-1-PBS in a different storage buffer formulation.

FBXO11 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 67365-1-PBS

Clone No.3C5E1

Host / Isotype

Mouse / IgG1

Reactivity

Human

Applications

WB, Indirect ELISA

Synonyms

F box only protein 11, F box protein 11, FBX11, FBXO11, FLJ12673, PRMT9, UBR6, UG063H01, VIT 1, VIT1, Vitiligo associated protein 1

---

Product Information

67365-1-PBS targets FBXO11 in WB, Indirect ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24401

  Product name: Recombinant human FBXO11 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 858-927 aa of BC012728

  Sequence: TDRNAICVNCIKKCHQGHDVEFIRHDRFFCDCGAGTLSNPCTLAGEPTHDTDTLYDSAPPIESNTLQHN

• Full Name: F-box protein 11
• Calculated Molecular Weight: 927 aa, 104 kDa
• Observed Molecular Weight: 94-104 kDa
• GenBank Accession Number: BC012728
• Gene Symbol: FBXO11
• Gene ID (NCBI): 80204
• RRID: AB_2882617
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q86XK2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.