FBXO11 Monoclonal antibody

• 

  WB analysis using 67365-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67365-1-Ig (FBXO11 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of U2OS using 67365-1-Ig

  U2OS cells were subjected to SDS PAGE followed by western blot with 67365-1-Ig (FBXO11 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 67365-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67365-1-Ig (FBXO11 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

FBXO11 Monoclonal Antibody for WB, ELISA

Cat No. 67365-1-Ig

Clone No.3C5E1

Publications(3)

Host / Isotype

Mouse / IgG1

Reactivity

Human and More (2)

Applications

WB, ELISA

Synonyms

F box only protein 11, F box protein 11, FBX11, FBXO11, FLJ12673, PRMT9, UBR6, UG063H01, VIT 1, VIT1, Vitiligo associated protein 1

---

Tested Applications

• Positive WB detected in: LNCaP cells, U2OS cells, HeLa cells, HEK-293 cells, K-562 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 3 publications below

Product Information

67365-1-Ig targets FBXO11 in WB, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Cited Reactivity: human, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24401

  Product name: Recombinant human FBXO11 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 858-927 aa of BC012728

  Sequence: TDRNAICVNCIKKCHQGHDVEFIRHDRFFCDCGAGTLSNPCTLAGEPTHDTDTLYDSAPPIESNTLQHN

• Full Name: F-box protein 11
• Calculated Molecular Weight: 927 aa, 104 kDa
• Observed Molecular Weight: 94-104 kDa
• GenBank Accession Number: BC012728
• Gene Symbol: FBXO11
• Gene ID (NCBI): 80204
• RRID: AB_2882617
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q86XK2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	J Clin Invest; PRMT5 mediated FUBP1 methylation accelerates prostate cancer progression; Authors - Weiwei Yan
human	WB	Cancers (Basel); FBXO11 Mediates Ubiquitination of ZEB1 and Modulates Epithelial-to-Mesenchymal Transition in Lung Cancer Cells; Authors - Xinyue Zhao ; KD Validated
mouse	WB	Pharmacol Res; Cardiac PDK4 promotes neutrophilic PFKL methylation and drives the innate immune response in diabetic myocardial infarction; Authors - Song Yang