Tested Applications
Positive WB detected in | RAW 264.7 cells, THP-1 cells |
Positive IHC detected in | human ovary cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | THP-1 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
13566-1-AP targets FCER1G in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag4442 Product name: Recombinant human FCER1G protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-87 aa of BC033872 Sequence: MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKVIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ Predict reactive species |
Full Name | Fc fragment of IgE, high affinity I, receptor for; gamma polypeptide |
Calculated Molecular Weight | 87 aa, 10 kDa |
Observed Molecular Weight | 10 kDa |
GenBank Accession Number | BC033872 |
Gene Symbol | FcRγ |
Gene ID (NCBI) | 2207 |
RRID | AB_3669165 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P30273 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
FCER1G (Fc receptor gamma-chain, FcRgamma), also known as Fc-epsilon RI-gamma, or IgE Fc receptor subunit gamma (FceRI gamma), is a component of the high-affinity immunoglobulin E (IgE) receptor (Fc epsilon RI) which is a tetrameric complex of one alpha subunit, one beta subunit, and two disulfide-linked gamma subunits (PMID: 2146219; 2531187). Fc epsilon RI is present exclusively on mast cells and basophils, mediating allergic inflammatory signaling (PMID: 17438574). FCER1G is widely expressed and contains an immunoreceptor tyrosine-based activation motif (ITAM) that transduces activation signals from various immunoreceptors (PMID: 19098920).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for FCER1G antibody 13566-1-AP | Download protocol |
IHC protocol for FCER1G antibody 13566-1-AP | Download protocol |
IF protocol for FCER1G antibody 13566-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |