Anti-Human FCRL1 Rabbit Recombinant Antibody, PBS Only

• 

  FC experiment of human PBMCs using 98557-1-RR (same clone as 98557-1-PBS)

  1x10^6 human PBMCs were surface stained with 0.25 ug Anti-Human FCRL1 Rabbit RecAb (98557-1-RR, Clone: 251080E1) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were not fixed. This data was developed using the same antibody clone with 98557-1-PBS in a different storage buffer formulation.

• 

  FC experiment of human PBMCs using 98557-1-RR (same clone as 98557-1-PBS)

  1x10^6 human PBMCs were surface stained with 0.25 ug Anti-Human FCRL1 Rabbit RecAb (98557-1-RR, Clone: 251080E1) (red) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were not fixed. This data was developed using the same antibody clone with 98557-1-PBS in a different storage buffer formulation.

• 

  FC experiment of Transfected CHO using 98557-1-RR (same clone as 98557-1-PBS)

  1x10^6 CHO Cells (left) or FCRL1(CD307a)-transfected CHO Cells (right) were surface stained with 0.25 ug Anti-Human FCRL1 Rabbit RecAb (98557-1-RR, Clone: 251080E1) and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were not fixed. This data was developed using the same antibody clone with 98557-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 98557-1-RR

  Biolayer interferometry (BLl) kinetic assays of 98557-1-RR against Human FCRL1 were performed. The affinity constant is 0.256 nM.

FCRL1 Uni-rAb^® Recombinant Antibody for FC

Cat No. 98557-1-PBS

Clone No.251080E1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

Synonyms

CD307a, Fc receptor-like protein 1, FcRH1, FcR-like protein 1, IFGP family protein 1

---

Product Information

98557-1-PBS targets FCRL1 in FC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3713

  Product name: Recombinant Human FCRL1 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 17-307 aa of BC033690

  Sequence: AELFLIASPSHPTEGSPVTLTCKMPFLQSSDAQFQFCFFRDTRALGPGWSSSPKLQIAAMWKEDTGSYWCEAQTMASKVLRSRRSQINVHRVPVADVSLETQPPGGQVMEGDRLVLICSVAMGTGDITFLWYKGAVGLNLQSKTQRSLTAEYEIPSVRESDAEQYYCVAENGYGPSPSGLVSITVRIPVSRPILMLRAPRAQAAVEDVLELHCEALRGSPPILYWFYHEDITLGSRSAPSGGGASFNLSLTEEHSGNYSCEANNGLGAQRSEAVTLNFTVPTGARSNHLTS

• Full Name: Fc receptor-like 1
• Calculated Molecular Weight: 429 aa, 47 kDa
• GenBank Accession Number: BC033690
• Gene Symbol: FCRL1
• Gene ID (NCBI): 115350
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q96LA6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Fc receptor-like protein 1 (FCRL1) is a type I transmembrane glycoprotein that plays a crucial role in regulating B-cell receptor (BCR)-mediated signaling responses (PMID:15479727). It contains intracellular tyrosine-based motifs that can modulate BCR signaling, leading to changes in calcium flux, proliferation, and antibody production (PMID: 37822931). FCRL1 is involved in regulating B-cell development and activation, with its signaling pathways influencing ERK activation through interactions with proteins such as GRB2. This regulation is essential for maintaining B-cell homeostasis and preventing the development of autoreactive B cells (PMID: 34697226).