FGFR4 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 81069-1-RR (same clone as 81069-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 81069-1-RR (FGFR4 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 81069-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 81069-1-RR (same clone as 81069-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 81069-1-RR (FGFR4 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 81069-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse lung using 81069-1-RR (same clone as 81069-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 81069-1-RR (FGFR4 antibody) at dilution of 1:500 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 81069-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 81069-1-RR

  Biolayer interferometry (BLl) kinetic assays of 81069-1-RR against Human FGFR4 were performed. The affinity constant is 25 nM.

FGFR4 Uni-rAb^® Recombinant Antibody for WB, IHC, Indirect ELISA

Cat No. 81069-1-PBS

Clone No.5P12

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

5P12, CD334, EC:2.7.10.1, FGFR 4, FGFR-4

---

Product Information

81069-1-PBS targets FGFR4 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag31013

  Product name: Recombinant human FGFR4 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 742-802 aa of BC011847

  Sequence: ALDKVLLAVSEEYLDLRLTFGPYSPSGGDASSTCSSSDSVFSHDPLPLGSSSFPFGSGVQT

• Full Name: fibroblast growth factor receptor 4
• Calculated Molecular Weight: 88 kDa
• Observed Molecular Weight: 100-110 kDa
• GenBank Accession Number: BC011847
• Gene Symbol: FGFR4
• Gene ID (NCBI): 2264
• RRID: AB_2918926
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P22455
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.