Tested Applications
| Positive WB detected in | MOLT-4 cells, HepG2 cells, Raji cells, Jurkat cells, HeLa cells, HT-29 cells, A549 cells |
| Positive IHC detected in | mouse lung tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:16000 |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
81069-1-RR targets FGFR4 in WB, IHC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag31013 Product name: Recombinant human FGFR4 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 742-802 aa of BC011847 Sequence: ALDKVLLAVSEEYLDLRLTFGPYSPSGGDASSTCSSSDSVFSHDPLPLGSSSFPFGSGVQT Predict reactive species |
| Full Name | fibroblast growth factor receptor 4 |
| Calculated Molecular Weight | 88 kDa |
| Observed Molecular Weight | 100-110 kDa |
| GenBank Accession Number | BC011847 |
| Gene Symbol | FGFR4 |
| Gene ID (NCBI) | 2264 |
| RRID | AB_2918926 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P22455 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for FGFR4 antibody 81069-1-RR | Download protocol |
| WB protocol for FGFR4 antibody 81069-1-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |







