Tested Applications
Positive WB detected in | Jurkat cells, HepG2 cells, human placenta tissue, K-562 cells |
Positive IP detected in | K-562 cells |
Positive IHC detected in | human breast cancer tissue, mouse kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | Caco-2 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 2 publications below |
WB | See 3 publications below |
IF | See 1 publications below |
IP | See 1 publications below |
Product Information
26841-1-AP targets FLVCR1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag25220 Product name: Recombinant human FLVCR1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-107 aa of BC048312 Sequence: MARPDDEEGAAVAPGHPLAKGYLPLPRGAPVGKESVELQNGPKAGTFPVNGPPRDSLAAASGVLGGPQTPLAPEEETQARLLPAGAGAETPGAESSPLPLTALSPRR Predict reactive species |
Full Name | feline leukemia virus subgroup C cellular receptor 1 |
Calculated Molecular Weight | 60 kDa |
Observed Molecular Weight | 60 kDa~70 kDa |
GenBank Accession Number | BC048312 |
Gene Symbol | FLVCR1 |
Gene ID (NCBI) | 28982 |
RRID | AB_2880654 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9Y5Y0 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
FLVCR1(feline leukemia virus subgroup C receptor 1) has been reported to have a crucial role in a variety of biological processes, including cell proliferation, cell death, apoptosis, oxidative stress response, cellular differentiation, and metabolism (PMID: 29532854). In addition, FLVCR1 can be applied as a clinical prognostic marker for patients with ESCC (PMID: 33842377).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for FLVCR1 antibody 26841-1-AP | Download protocol |
IHC protocol for FLVCR1 antibody 26841-1-AP | Download protocol |
IF protocol for FLVCR1 antibody 26841-1-AP | Download protocol |
IP protocol for FLVCR1 antibody 26841-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
J Nanobiotechnology Apoptotic metabolites ameliorate bone aging phenotypes via TCOF1/FLVCR1-mediated mitochondrial homeostasis
| ||
Cell Rep Flvcr1a deficiency promotes heme-based energy metabolism dysfunction in skeletal muscle | ||
Cell Rep Med Dysregulation of FLVCR1a-dependent mitochondrial calcium handling in neural progenitors causes congenital hydrocephalus
| ||
Biochim Biophys Acta Mol Basis Dis The role of FLVCR1 and FLVCR2 in choline transport in the Caco-2 intestinal epithelial cell model and rat small intestine |