FLVCR1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• FLVCR1 Polyclonal antibody (26841-1-AP)

• Featured Product
• KD/KO Validated

FLVCR1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 26841-1-AP Copied!

Publications (8)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

Feline leukemia virus subgroup C receptor-related protein 1, FLVCR, Heme transporter FLVCR1

• 

  WB analysis of Jurkat using 26841-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 26841-1-AP (FLVCR1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human placenta using 26841-1-AP

  human placenta tissue were subjected to SDS PAGE followed by western blot with 26841-1-AP (FLVCR1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 26841-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26841-1-AP (FLVCR1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of K-562 using 26841-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 26841-1-AP (FLVCR1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 26841-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 26841-1-AP (FLVCR1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of K-562 using 26841-1-AP

  IP result of anti-FLVCR1 (IP:26841-1-AP, 4ug; Detection:26841-1-AP 1:500) with K-562 cells lysate 4400 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 26841-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 26841-1-AP (FLVCR1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse kidney using 26841-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 26841-1-AP (FLVCR1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of Caco-2 using 26841-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed Caco-2 cells using 26841-1-AP (FLVCR1 antibody) at dilution of 1:50 and Alexa Fluor 488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for FLVCR1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: Jurkat cells, HepG2 cells, human placenta tissue, K-562 cells, mouse kidney tissue
• Positive IP detected in: K-562 cells
• Positive IHC detected in: human breast cancer tissue, mouse kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: Caco-2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26841-1-AP targets FLVCR1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25220

  Product name: Recombinant human FLVCR1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-107 aa of BC048312

  Sequence: MARPDDEEGAAVAPGHPLAKGYLPLPRGAPVGKESVELQNGPKAGTFPVNGPPRDSLAAASGVLGGPQTPLAPEEETQARLLPAGAGAETPGAESSPLPLTALSPRR

• Full Name: feline leukemia virus subgroup C cellular receptor 1
• Calculated Molecular Weight: 60 kDa
• Observed Molecular Weight: 60 kDa~70 kDa
• GenBank Accession Number: BC048312
• Gene Symbol: FLVCR1
• Gene ID (NCBI): 28982
• RRID: AB_2880654
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y5Y0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FLVCR1(feline leukemia virus subgroup C receptor 1) has been reported to have a crucial role in a variety of biological processes, including cell proliferation, cell death, apoptosis, oxidative stress response, cellular differentiation, and metabolism (PMID: 29532854). In addition, FLVCR1 can be applied as a clinical prognostic marker for patients with ESCC (PMID: 33842377).

Publications

What published studies show

The FLVCR1 antibody (Cat# 26841-1-AP) has 8 total citations published in journals including Nature Communications, Journal of Nanobiotechnology, Cell Reports Medicine, Cell Reports, Clinical & Experimental Ophthalmology, BBA Molecular Basis of Disease, Scientific Reports, and Journal of Peripheral Nervous System. Research fields span mitochondrial heme export, bone aging and mitochondrial homeostasis, congenital hydrocephalus, skeletal muscle energy metabolism, retinal degeneration, intestinal choline transport, prostate cancer progression, and hereditary retinopathy-sensory neuropathy. Applications include WB, IP, and IF in human and mouse samples.

Automatically generated from the 8 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human, mouse	WB,IP	Nat Commun; Heme allocation in eukaryotic cells relies on mitochondrial heme export through FLVCR1b to cytosolic GAPDH.; Authors - Dhanya Thamaraparambil Jayaram
mouse	WB	J Nanobiotechnology; Apoptotic metabolites ameliorate bone aging phenotypes via TCOF1/FLVCR1-mediated mitochondrial homeostasis; Authors - Yan Qu ; KD Validated
mouse,human	WB,IP,IF	Cell Rep Med; Dysregulation of FLVCR1a-dependent mitochondrial calcium handling in neural progenitors causes congenital hydrocephalus; Authors - Francesca Bertino ; KD Validated
		Cell Rep; Flvcr1a deficiency promotes heme-based energy metabolism dysfunction in skeletal muscle; Authors - Miriam Mistretta
mouse	WB,IF	Clin Exp Ophthalmol; FLVCR1 Deficiency Impairs Mitochondrial Homeostasis in Retinal Degeneration: Choline as a Potential Therapy.; Authors - Yi Wang ; KO Validated
human	WB	Biochim Biophys Acta Mol Basis Dis; The role of FLVCR1 and FLVCR2 in choline transport in the Caco-2 intestinal epithelial cell model and rat small intestine; Authors - Tomoya Yasujima