FLVCR1 Polyclonal antibody

• 

  WB analysis of Jurkat using 26841-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 26841-1-AP (FLVCR1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human placenta using 26841-1-AP

  human placenta tissue were subjected to SDS PAGE followed by western blot with 26841-1-AP (FLVCR1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 26841-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26841-1-AP (FLVCR1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of K-562 using 26841-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 26841-1-AP (FLVCR1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 26841-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 26841-1-AP (FLVCR1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IP experiment of K-562 using 26841-1-AP

  IP result of anti-FLVCR1 (IP:26841-1-AP, 4ug; Detection:26841-1-AP 1:500) with K-562 cells lysate 4400 ug.

• 

  IHC staining of human breast cancer using 26841-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 26841-1-AP (FLVCR1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 26841-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 26841-1-AP (FLVCR1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of Caco-2 using 26841-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed Caco-2 cells using 26841-1-AP (FLVCR1 antibody) at dilution of 1:50 and Alexa Fluor 488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

FLVCR1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 26841-1-AP

Publications(4)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

Feline leukemia virus subgroup C receptor-related protein 1, FLVCR, Heme transporter FLVCR1

---

Tested Applications

• Positive WB detected in: Jurkat cells, HepG2 cells, human placenta tissue, K-562 cells, mouse kidney tissue
• Positive IP detected in: K-562 cells
• Positive IHC detected in: human breast cancer tissue, mouse kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: Caco-2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 3 publications below
• IF: See 1 publications below
• IP: See 1 publications below

Product Information

26841-1-AP targets FLVCR1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25220

  Product name: Recombinant human FLVCR1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-107 aa of BC048312

  Sequence: MARPDDEEGAAVAPGHPLAKGYLPLPRGAPVGKESVELQNGPKAGTFPVNGPPRDSLAAASGVLGGPQTPLAPEEETQARLLPAGAGAETPGAESSPLPLTALSPRR

• Full Name: feline leukemia virus subgroup C cellular receptor 1
• Calculated Molecular Weight: 60 kDa
• Observed Molecular Weight: 60 kDa~70 kDa
• GenBank Accession Number: BC048312
• Gene Symbol: FLVCR1
• Gene ID (NCBI): 28982
• RRID: AB_2880654
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y5Y0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FLVCR1(feline leukemia virus subgroup C receptor 1) has been reported to have a crucial role in a variety of biological processes, including cell proliferation, cell death, apoptosis, oxidative stress response, cellular differentiation, and metabolism (PMID: 29532854). In addition, FLVCR1 can be applied as a clinical prognostic marker for patients with ESCC (PMID: 33842377).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	J Nanobiotechnology; Apoptotic metabolites ameliorate bone aging phenotypes via TCOF1/FLVCR1-mediated mitochondrial homeostasis; Authors - Yan Qu ; KD Validated
		Cell Rep; Flvcr1a deficiency promotes heme-based energy metabolism dysfunction in skeletal muscle; Authors - Miriam Mistretta
mouse,human	WB,IP,IF	Cell Rep Med; Dysregulation of FLVCR1a-dependent mitochondrial calcium handling in neural progenitors causes congenital hydrocephalus; Authors - Francesca Bertino ; KD Validated
human	WB	Biochim Biophys Acta Mol Basis Dis; The role of FLVCR1 and FLVCR2 in choline transport in the Caco-2 intestinal epithelial cell model and rat small intestine; Authors - Tomoya Yasujima