FMNL2 Monoclonal antibody

• 

  WB analysis using 68551-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 68551-1-Ig (FMNL2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of hTERT-RPE1 using 68551-1-Ig

  hTERT-RPE1 cells were subjected to SDS PAGE followed by western blot with 68551-1-Ig (FMNL2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

FMNL2 Monoclonal Antibody for WB, ELISA

Cat No. 68551-1-Ig

Clone No.3E8C12

Host / Isotype

Mouse / IgG2a

Reactivity

Human

Applications

WB, ELISA

Synonyms

FHOD2, FLJ37546, FMNL2, formin like 2, Formin like protein 2, KIAA1902

---

Tested Applications

• Positive WB detected in: HeLa cells, hTERT-RPE1 cells, HEK-293 cells, A549 cells, HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

68551-1-Ig targets FMNL2 in WB, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34164

  Product name: Recombinant human FMNL2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 400-520 aa of BC167159

  Sequence: ENISHLSEKLQDTENEAMSKIVELEKQLMQRNKELDVVREIYKDANTQVHTLRKMVKEKEEAIQRQSTLEKKIHELEKQGTIKIQKKGDGDIAILPVVASGTLSMGSEVVAGNSVGPTMGA

• Full Name: formin-like 2
• Observed Molecular Weight: 140-150 kDa
• GenBank Accession Number: BC167159
• Gene Symbol: FMNL2
• Gene ID (NCBI): 114793
• RRID: AB_3085255
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q96PY5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Formin-like 2 (FMNL2), also known as FRL3 or FHOD2, a member of the diaphanous-related formins, contains a GTPase-binding domain and autoregulatory domains, and is proposed to function as a downstream effector of Rho family guanosine triphosphatases (GTPases) (PMID:15950879). FMNL2 mRNA is expressed in many normal tissues and dysregulated in several cancers such as colorectal cancer, melanoma and involved in invasive behaviours and progression of cancer cells.