FMNL2 Monoclonal antibody, PBS Only

• 

  WB analysis using 68551-1-Ig (same clone as 68551-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68551-1-Ig (FMNL2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68551-1-PBS in a different storage buffer formulation.

• 

  WB analysis of hTERT-RPE1 using 68551-1-Ig (same clone as 68551-1-PBS)

  hTERT-RPE1 cells were subjected to SDS PAGE followed by western blot with 68551-1-Ig (FMNL2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68551-1-PBS in a different storage buffer formulation.

FMNL2 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 68551-1-PBS

Clone No.3E8C12

Host / Isotype

Mouse / IgG2a

Reactivity

Human

Applications

WB, Indirect ELISA

Synonyms

FHOD2, FLJ37546, FMNL2, formin like 2, Formin like protein 2, KIAA1902

---

Product Information

68551-1-PBS targets FMNL2 in WB, Indirect ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34164

  Product name: Recombinant human FMNL2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 400-520 aa of BC167159

  Sequence: ENISHLSEKLQDTENEAMSKIVELEKQLMQRNKELDVVREIYKDANTQVHTLRKMVKEKEEAIQRQSTLEKKIHELEKQGTIKIQKKGDGDIAILPVVASGTLSMGSEVVAGNSVGPTMGA

• Full Name: formin-like 2
• Observed Molecular Weight: 140-150 kDa
• GenBank Accession Number: BC167159
• Gene Symbol: FMNL2
• Gene ID (NCBI): 114793
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q96PY5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Formin-like 2 (FMNL2), also known as FRL3 or FHOD2, a member of the diaphanous-related formins, contains a GTPase-binding domain and autoregulatory domains, and is proposed to function as a downstream effector of Rho family guanosine triphosphatases (GTPases) (PMID:15950879). FMNL2 mRNA is expressed in many normal tissues and dysregulated in several cancers such as colorectal cancer, melanoma and involved in invasive behaviours and progression of cancer cells.