Use Able AI chat for product recommendations

FMO1 Monoclonal antibody

FMO1 Monoclonal Antibody for WB, ELISA

Cat No. 61032-3-Ig
Clone No.1B9G6

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig, rabbit

Applications

WB, ELISA

Dimethylaniline monooxygenase [N-oxide-forming] 1, EC:1.14.13.148, Fetal hepatic flavin-containing monooxygenase 1, Flavin-containing monooxygenase 1, Trimethylamine monooxygenase

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inpig liver tissue, pig kidney tissue, rabbit kidney tissue, Rabbit liver tissue, Rat liver tissue, Mouse liver tissue, Rat kidney tissue, Mouse kidney tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

61032-3-Ig targets FMO1 in WB, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.

Tested Reactivity human, mouse, rat, pig, rabbit
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag34286

Product name: Recombinant human FMO1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 100-430 aa of NM_001282692

Sequence: LLKHIQFKTKVCSVTKCSDSAVSGQWEVVTMHEEKQESAIFDAVMVCTGFLTNPYLPLDSFPGINAFKGQYFHSRQYKHPDIFKDKRVLVIGMGNSGTDIAVEASHLAEKVFLSTTGGGWVISRIFDSGYPWDMVFMTRFQNMLRNSLPTPIVTWLMERKINNWLNHANYGLIPEDRTQLKEFVLNDELPGRIITGKVFIRPSIKEVKENSVIFNNTSKEEPIDIIVFATGYTFAFPFLDESVVKVEDGQASLYKYIFPAHLQKPTLAIIGLIKPLGSMIPTGETQARWAVRVLKGVNKLPPPSVMIEEINARKENKPSWFGLCYCKALQS

Predict reactive species
Full Name flavin containing monooxygenase 1
Calculated Molecular Weight60 kDa
Observed Molecular Weight50-53 kDa
GenBank Accession NumberNM_001282692
Gene Symbol FMO1
Gene ID (NCBI) 2326
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ01740
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Flavin-containing monooxygenase 1 (FMO1) belongs to the FMO family. FMO1 is an enzyme that catalyzes the oxygenation of a series of sulfur-containing and nitrogen-containing substrates, and thus is involved in a series of drugs and xenobiotics metabolism. FMO1 can regulate PPAR-α and mediate metabolic processes. FMO1 is expressed at relatively high levels in human fetal liver and also represents the major FMO enzyme in the adult human and rabbit intestine and kidney (PMID: 11809920, 30757917, 37553313). Human FMO1 has 2 isoforms with the molecular weights of 53 kDa and 60 kDa.

Protocols

Product Specific Protocols
WB protocol for FMO1 antibody 61032-3-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...