FMO1 Monoclonal antibody, PBS Only

• 

  WB analysis using 61032-3-Ig (same clone as 61032-3-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 61032-3-Ig (FMO1 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 61032-3-PBS in a different storage buffer formulation.

• 

  WB analysis using 61032-3-Ig (same clone as 61032-3-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 61032-3-Ig (FMO1 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 61032-3-PBS in a different storage buffer formulation.

• 

  WB analysis of pig kidney using 61032-3-Ig (same clone as 61032-3-PBS)

  pig kidney tissue were subjected to SDS PAGE followed by western blot with 61032-3-Ig (FMO1 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 61032-3-PBS in a different storage buffer formulation.

FMO1 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 61032-3-PBS

Clone No.1B9G6

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig, rabbit

Applications

WB, Indirect ELISA

Synonyms

Dimethylaniline monooxygenase [N-oxide-forming] 1, EC:1.14.13.148, Fetal hepatic flavin-containing monooxygenase 1, Flavin-containing monooxygenase 1, Trimethylamine monooxygenase

---

Product Information

61032-3-PBS targets FMO1 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.

• Tested Reactivity: human, mouse, rat, pig, rabbit
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34286

  Product name: Recombinant human FMO1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 100-430 aa of NM_001282692

  Sequence: LLKHIQFKTKVCSVTKCSDSAVSGQWEVVTMHEEKQESAIFDAVMVCTGFLTNPYLPLDSFPGINAFKGQYFHSRQYKHPDIFKDKRVLVIGMGNSGTDIAVEASHLAEKVFLSTTGGGWVISRIFDSGYPWDMVFMTRFQNMLRNSLPTPIVTWLMERKINNWLNHANYGLIPEDRTQLKEFVLNDELPGRIITGKVFIRPSIKEVKENSVIFNNTSKEEPIDIIVFATGYTFAFPFLDESVVKVEDGQASLYKYIFPAHLQKPTLAIIGLIKPLGSMIPTGETQARWAVRVLKGVNKLPPPSVMIEEINARKENKPSWFGLCYCKALQS

• Full Name: flavin containing monooxygenase 1
• Calculated Molecular Weight: 60 kDa
• Observed Molecular Weight: 50-53 kDa
• GenBank Accession Number: NM_001282692
• Gene Symbol: FMO1
• Gene ID (NCBI): 2326
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q01740
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Flavin-containing monooxygenase 1 (FMO1) belongs to the FMO family. FMO1 is an enzyme that catalyzes the oxygenation of a series of sulfur-containing and nitrogen-containing substrates, and thus is involved in a series of drugs and xenobiotics metabolism. FMO1 can regulate PPAR-α and mediate metabolic processes. FMO1 is expressed at relatively high levels in human fetal liver and also represents the major FMO enzyme in the adult human and rabbit intestine and kidney (PMID: 11809920, 30757917, 37553313). Human FMO1 has 2 isoforms with the molecular weights of 53 kDa and 60 kDa.