Tested Applications
| Positive WB detected in | human plasma, NIH/3T3 cells, MDA-MB-453s cells |
| Positive IP detected in | NIH/3T3 cells |
| Positive IF-P detected in | rat skin tissue, mouse brain tissue |
| Positive IF/ICC detected in | NIH/3T3 cells, HUVEC cells |
| Positive FC (Intra) detected in | NIH/3T3 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:20000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 9 publications below |
| WB | See 679 publications below |
| IHC | See 2 publications below |
| IF | See 194 publications below |
| IP | See 2 publications below |
| ELISA | See 2 publications below |
Product Information
15613-1-AP targets Fibronectin in WB, IF/ICC, IF-P, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, rabbit, bovine, hamster, sheep, medaka embryos |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag8004 Product name: Recombinant human FN1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 2177-2386 aa of BC005858 Sequence: DQQRHKVREEVVTVGNSVNEGLNQPTDDSCFDPYTVSHYAVGDEWERMSESGFKLLCQCLGFGSGHFRCDSSRWCHDNGVNYKIGEKWDRQGENGQMMSCTCLGNGKGEFKCDPHEATCYDDGKTYHVGEQWQKEYLGAICSCTCFGGQRGWRCDNCRRPGGEPSPEGTTGQSYNQYSQRYHQRTNTNVNCPIECFMPLDVQADREDSRE Predict reactive species |
| Full Name | fibronectin 1 |
| Calculated Molecular Weight | 2386 aa, 263 kDa |
| Observed Molecular Weight | 250-275 kDa |
| GenBank Accession Number | BC005858 |
| Gene Symbol | Fibronectin |
| Gene ID (NCBI) | 2335 |
| RRID | AB_2105691 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P02751 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Fibronectins play a role in cell adhesion, motility, wound healing, and the maintenance of cell shape. Fibronectins bind to cell surfaces via interactions with integrins and various molecules such as collagen, fibrin, heparin, DNA, and actin (PMID: 3326130). Cellular interaction with fibronectin (FN1) promotes cell cycle progression and proliferation by influencing cyclins.
What is the molecular weight of FN1?
The molecular weight of FN1 is 220 kDa.
What is the tissue specificity of FN1?
FN1 is a large glycoprotein that exists in both a soluble form in plasma (plasma FN1) and other body fluids and an insoluble form in the extracellular matrix (cellular FN1) (PMID: 21923916). Plasma FN1, or the dimeric form, is secreted by hepatocytes, whereas cellular FN1, the dimeric or cross-linked multimeric form, is produced by fibroblasts and epithelial cells and deposited as fibrils in the extracellular matrix.
What are the post-translational modifications of FN1?
FN1 is often sulfated and its C-terminal NC1 peptide, anastellin, is produced as a result of proteolytic processing and can inhibit tumor growth, angiogenesis, and metastasis by activating p38 MAPK and inhibiting lysophospholipid signaling (PMID: 11209058).
What is FN1's role in embryogenesis?
Fibronectin has a crucial role in the development of the left-right body axis during embryogenesis (PMID: 21466802).
What is FN1's involvement in disease?
Fibronectin glomerulopathy is a kidney disease that eventually leads to end-stage renal disease and is caused by mutations in the FN1 gene. Mutations in FN1 lead to the production of abnormal fibronectin protein that is deposited in the glomeruli of the kidney (PMID: 18268355).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for Fibronectin antibody 15613-1-AP | Download protocol |
| IF protocol for Fibronectin antibody 15613-1-AP | Download protocol |
| IP protocol for Fibronectin antibody 15613-1-AP | Download protocol |
| WB protocol for Fibronectin antibody 15613-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Adv Mater Neonatal Tissue-derived Extracellular Vesicle Therapy (NEXT): A Potent Strategy for Precision Regenerative Medicine | ||
Cell Metab The phytochemical hyperforin triggers thermogenesis in adipose tissue via a Dlat-AMPK signaling axis to curb obesity. | ||
Bioact Mater Bioengineered platelet nanoplatform enables renal-targeted dexamethasone delivery for chronic nephritis therapy with dual anti-inflammatory/anti-fibrotic effects and minimized systemic toxicity | ||
J Clin Invest Mitochondrial dysfunction in macrophages promotes inflammation and suppresses repair after myocardial infarction | ||
Nat Protoc Responsive and activable nanomedicines for remodeling the tumor microenvironment. | ||
Nat Commun Schwann cells regulate tumor cells and cancer-associated fibroblasts in the pancreatic ductal adenocarcinoma microenvironment |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH S (Verified Customer) (01-06-2026) | excellent
![]() |
FH Zach (Verified Customer) (08-29-2025) | This antibody works great with chronic pancreatitis samples.
|
FH Ilaria (Verified Customer) (08-11-2025) | The fibronectin antibody performed very well, providing a strong and clear signal even at a higher dilution of 1:500. It was tested on mouse brain samples that were snap-frozen after collection using dry ice and 2-methylbutane, then post-fixed with acetone and ethanol. Blood vessel structures were clearly visualised, and the antibody also allowed for the assessment of BBB leakage.
|
FH Angie (Verified Customer) (07-26-2025) | WB showed a single band above 250 kDa at dilution of 1:500 incubated overnight at 4 °C. Secondary antibody: Donkey-anti-rabbit (Alexa Fluor 680) at 1:20000 dilution incubated at room temperature for 1 hour.
![]() |
FH Christelle (Verified Customer) (12-19-2024) | Immunofluorescence analysis of (PFA 4%) fixed and (BSA 1%, Saponin 0.1%) permeabilized HRMC cells using the Fibronectin antibody #15613-1-AP at dilution 1:100 and goat anti-rabbit antibody AF488 labelled, Abberior STAR Red membrane probe (yellow), Dapi (nucleus, blue). Find attached 2 files : - merged channels: dapi, green - merged channels: dapi, green, yellow
![]() |
FH Ruchi (Verified Customer) (06-02-2023) | The Ab was tried on mouse skin on diabetic wounds.
![]() |
FH PK (Verified Customer) (03-20-2023) | excellent
![]() |
FH Susanne (Verified Customer) (08-23-2022) | under reduced conditions, blocked with 5% milk powder, incubation over night 4°C
![]() |
FH Pankhuri (Verified Customer) (08-19-2022) | I tried this antibody for IF in neural stem cells. It works great in the conc. 1:200.
![]() |
FH Ren Jie (Verified Customer) (07-11-2022) | Very clean bands near 220 kD indicating fibronectin monomer
![]() |
FH SD (Verified Customer) (07-08-2022) | Good
![]() |
FH zunyi (Verified Customer) (03-11-2022) | This ab is used for immunohistochemistry on mouse paraffin-embedded sections. Antigen-retrieve, using pH 6.0 citric buffer, was performed prior to staining.
|
FH Lindsey (Verified Customer) (05-24-2021) | Works beautifully! Looking forward to working more with this antibody in different tissue/prep types
![]() |



































