Use Able AI chat for product recommendations

PSMA/GCPII Polyclonal antibody

PSMA/GCPII Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 13163-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, ELISA, Blocking assay

FOLH1, PSMA, Cell growth-inhibiting gene 27 protein, EC:3.4.17.21, FGCP

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inLNCaP cells, human liver tissue, mouse kidney tissue, rat kidney tissue
Positive IHC detected inhuman prostate cancer tissue, human colon cancer tissue, human gliomas tissue, mouse kidney tissue, rat kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inLNCaP cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

13163-1-AP targets PSMA/GCPII in WB, IHC, IF/ICC, ELISA, Blocking assay applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, monkey
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag3812

Product name: Recombinant human FOLH1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 45-385 aa of BC025672

Sequence: SSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGG

Predict reactive species
Full Name folate hydrolase (prostate-specific membrane antigen) 1
Calculated Molecular Weight 719 aa, 81 kDa
Observed Molecular Weight 100 kDa, 120 kDa
GenBank Accession NumberBC025672
Gene Symbol PSMA
Gene ID (NCBI) 2346
RRIDAB_2106442
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ04609
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PSMA(Prostate-specific membrane antigen) is also named as FOLH1, FOLH, NAALAD1, PSM and belongs to the peptidase M28 family. PSMA is a 100-120 kDa integral transmembrane glycoprotein, considered to be a highly specific marker of the prostate gland, and has successfully been used as a marker of circulating prostatic epithelial cells(PMID:10074909; 15680901). It is involved in conversion of the major neurotransmitter (NAAG) to NAA and free glutamate. It has 8 isoforms produced by alternative splicing.

Protocols

Product Specific Protocols
IF protocol for PSMA/GCPII antibody 13163-1-APDownload protocol
IHC protocol for PSMA/GCPII antibody 13163-1-APDownload protocol
WB protocol for PSMA/GCPII antibody 13163-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

ACS Sens

Rolling Circle Amplification-Assisted Flow Cytometry Approach for Simultaneous Profiling of Exosomal Surface Proteins.

Authors - Xiaoyi Gao
IHC

Eur J Nucl Med Mol Imaging

Prostate Specifc Membrane Antigen in Human and Mouse Tissue

Authors -
mouseIHC

J Nucl Med

Molecular imaging of Neuroendocrine Prostate Cancer by targeting Delta-like Ligand 3.

Authors - Joshua Aaron Korsen
humanWB

J Control Release

PSMA-targeted nanoparticles for specific penetration of blood-brain tumor barrier and combined therapy of brain metastases.

Authors - Jiang Ni
ratWB

Front Pharmacol

Increasing Aspartoacylase in the Central Amygdala: The Common Mechanism of Gastroprotective Effects of Monoamine-Based Antidepressants Against Stress.

Authors - Kaiyun Yao
monkeyWB

bioRxiv

Dysregulated calcium signaling in the aged macaque entorhinal cortex associated with tau hyperphosphorylation

Authors - S Bathla
Loading...
||
New chat

Able

正在加载,请稍候...