• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated FOLR1 Polyclonal antibody

FOLR1 Polyclonal Antibody for
Cat No. CL488-23355

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Folate receptor alpha, folate receptor 1 (adult), Folate receptor 1, FBP, Adult folate-binding protein

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

CL488-23355 targets FOLR1 in applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag19959

Product name: Recombinant human FOLR1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 55-93 aa of BC002947

Sequence: EQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMA

Predict reactive species
Full Name folate receptor 1 (adult)
Calculated Molecular Weight 257 aa, 30 kDa
Observed Molecular Weight 38 kDa
GenBank Accession NumberBC002947
Gene Symbol FOLR1
Gene ID (NCBI) 2348
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP15328
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Folate receptor 1 (FOLR1), also known as folate receptor alpha or adult folate-binding protein (FBP), is a 38-kDa glycoprotein belonging to the folate receptor family (PMID:15094207; 23528302). The receptor binds to folate and reduced folic acid derivatives and mediates delivery of 5-methyltetrahydrofolate to the interior of cells. FOLR1 is a secreted protein that either anchors to membranes via a glycosyl-phosphatidylinositol linkage or exists in a soluble form. FOLR1 expression is often limited to the apical surfaces of epithelium in the lung, kidney and choroid plexus but is differentially overexpressed in a variety of solid tumors such as ovarian cancer, non-small cell lung cancer, breast cancer, kidney cancer and high-grade osteosarcoma (PMID: 23528302; 23357463).

Loading...
||
New chat

Able

正在加载,请稍候...