Tested Applications
| Positive WB detected in | HeLa cells, JAR cells |
| Positive IHC detected in | human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:12000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
23355-1-AP targets FOLR1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, rat, camelus bactrianus |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag19959 Product name: Recombinant human FOLR1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 55-93 aa of BC002947 Sequence: EQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMA Predict reactive species |
| Full Name | folate receptor 1 (adult) |
| Calculated Molecular Weight | 257 aa, 30 kDa |
| Observed Molecular Weight | 38 kDa |
| GenBank Accession Number | BC002947 |
| Gene Symbol | FOLR1 |
| Gene ID (NCBI) | 2348 |
| RRID | AB_2879264 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P15328 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Folate receptor 1 (FOLR1), also known as folate receptor alpha or adult folate-binding protein (FBP), is a 38-kDa glycoprotein belonging to the folate receptor family (PMID:15094207; 23528302). The receptor binds to folate and reduced folic acid derivatives and mediates delivery of 5-methyltetrahydrofolate to the interior of cells. FOLR1 is a secreted protein that either anchors to membranes via a glycosyl-phosphatidylinositol linkage or exists in a soluble form. FOLR1 expression is often limited to the apical surfaces of epithelium in the lung, kidney and choroid plexus but is differentially overexpressed in a variety of solid tumors such as ovarian cancer, non-small cell lung cancer, breast cancer, kidney cancer and high-grade osteosarcoma (PMID: 23528302; 23357463).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for FOLR1 antibody 23355-1-AP | Download protocol |
| IHC protocol for FOLR1 antibody 23355-1-AP | Download protocol |
| WB protocol for FOLR1 antibody 23355-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The FOLR1 Polyclonal antibody (Cat# 23355-1-AP) has 18 citations across journals including ACS Nano, J Am Chem Soc, Advanced Science, Journal of Controlled Release, International Journal of Biological Macromolecules, ACS Applied Materials & Interfaces, Journal of Medicinal Chemistry, Biochemical Pharmacology, International Journal of Molecular Sciences, Cancers, Biology, BMC Cancer, Molecular Carcinogenesis, Nanotechnology, Applied Radiation Isotopes, Human Mutation, and Reproduction in Domestic Animals. Research fields span oncology, nanomedicine/drug delivery, folate metabolism, neurology, and reproductive/developmental biology.
| Species | Application | Title |
|---|---|---|
ACS Nano Synchronization of Nanoparticle Sensitization and Radiosensitizing Chemotherapy through Cell Cycle Arrest Achieving Ultralow X-ray Dose Delivery to Pancreatic Tumors. | ||
Adv Sci (Weinh) Hierarchical Targeting Nanodrug with Holistic DNA Protection for Effective Treatment of Acute Kidney Injury | ||
J Control Release Folate-targeted nanoparticles for glutamine metabolism inhibition enhance anti-tumor immunity and suppress tumor growth in ovarian cancer | ||
Int J Biol Macromol Improved epirubicin delivery selectivity to bladder cancer achieved by functionalized hydroxyethyl starch-based prodrug | ||
ACS Appl Mater Interfaces Design and Fabrication of Multifunctional Sericin Nanoparticles for Tumor Targeting and pH-Responsive Subcellular Delivery of Cancer Chemotherapy Drugs. |
Reviews
What customers say
The single available review (4/5 stars) reports using this antibody at a 1:50 dilution on MDA-MB-231 cells for both Western Blot and Immunofluorescence. The reviewer noted that while the antibody performed adequately overall, it produced non-specific cytosolic staining during the immunofluorescence application. No other reviews are currently available for this product.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Marvin (Verified Customer) (12-01-2022) | The antibody had non-specific staining of the cytosol of MDA-MB-231 cells while performing immunofluorescent analysis.
 |
