Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

FOLR1 Polyclonal antibody

FOLR1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human and More (3)

Applications

WB, IHC, IF/ICC, ELISA

Folate receptor alpha, folate receptor 1 (adult), Folate receptor 1, FBP, Adult folate-binding protein

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for FOLR1 in ?

Tested Applications

Positive WB detected inHeLa cells, JAR cells
Positive IHC detected inhuman breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:12000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

23355-1-AP targets FOLR1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse, rat, camelus bactrianus
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag19959

Product name: Recombinant human FOLR1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 55-93 aa of BC002947

Sequence: EQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMA

Predict reactive species
Full Name folate receptor 1 (adult)
Calculated Molecular Weight 257 aa, 30 kDa
Observed Molecular Weight 38 kDa
GenBank Accession NumberBC002947
Gene Symbol FOLR1
Gene ID (NCBI) 2348
RRIDAB_2879264
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP15328
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Folate receptor 1 (FOLR1), also known as folate receptor alpha or adult folate-binding protein (FBP), is a 38-kDa glycoprotein belonging to the folate receptor family (PMID:15094207; 23528302). The receptor binds to folate and reduced folic acid derivatives and mediates delivery of 5-methyltetrahydrofolate to the interior of cells. FOLR1 is a secreted protein that either anchors to membranes via a glycosyl-phosphatidylinositol linkage or exists in a soluble form. FOLR1 expression is often limited to the apical surfaces of epithelium in the lung, kidney and choroid plexus but is differentially overexpressed in a variety of solid tumors such as ovarian cancer, non-small cell lung cancer, breast cancer, kidney cancer and high-grade osteosarcoma (PMID: 23528302; 23357463).

Protocols

Product Specific Protocols
IF protocol for FOLR1 antibody 23355-1-APDownload protocol
IHC protocol for FOLR1 antibody 23355-1-APDownload protocol
WB protocol for FOLR1 antibody 23355-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The FOLR1 Polyclonal antibody (Cat# 23355-1-AP) has 18 citations across journals including ACS Nano, J Am Chem Soc, Advanced Science, Journal of Controlled Release, International Journal of Biological Macromolecules, ACS Applied Materials & Interfaces, Journal of Medicinal Chemistry, Biochemical Pharmacology, International Journal of Molecular Sciences, Cancers, Biology, BMC Cancer, Molecular Carcinogenesis, Nanotechnology, Applied Radiation Isotopes, Human Mutation, and Reproduction in Domestic Animals. Research fields span oncology, nanomedicine/drug delivery, folate metabolism, neurology, and reproductive/developmental biology.

SpeciesApplicationTitle
humanWB,IHC

ACS Nano

Synchronization of Nanoparticle Sensitization and Radiosensitizing Chemotherapy through Cell Cycle Arrest Achieving Ultralow X-ray Dose Delivery to Pancreatic Tumors.

Authors - Divinah Manoharan
humanWB

J Am Chem Soc

Cancer Selective Target Degradation by Folate-Caged PROTACs.

Authors - Jing Liu
  • KD Validated
human,ratWB

Adv Sci (Weinh)

Hierarchical Targeting Nanodrug with Holistic DNA Protection for Effective Treatment of Acute Kidney Injury

Authors - Qiaohui Chen
human,mouseIF

J Control Release

Folate-targeted nanoparticles for glutamine metabolism inhibition enhance anti-tumor immunity and suppress tumor growth in ovarian cancer

Authors - Shuning Chen
ratIHC

Int J Biol Macromol

Improved epirubicin delivery selectivity to bladder cancer achieved by functionalized hydroxyethyl starch-based prodrug

Authors - Xiaohan Pan
humanWB

ACS Appl Mater Interfaces

Design and Fabrication of Multifunctional Sericin Nanoparticles for Tumor Targeting and pH-Responsive Subcellular Delivery of Cancer Chemotherapy Drugs.

Authors - Lei Huang

Reviews

    4.0 out of 5
Add a review

1 verified customer reviews

What customers say

The single available review (4/5 stars) reports using this antibody at a 1:50 dilution on MDA-MB-231 cells for both Western Blot and Immunofluorescence. The reviewer noted that while the antibody performed adequately overall, it produced non-specific cytosolic staining during the immunofluorescence application. No other reviews are currently available for this product.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Marvin (Verified Customer) (12-01-2022)

The antibody had non-specific staining of the cytosol of MDA-MB-231 cells while performing immunofluorescent analysis.

  • Applications: Western Blot, Immunofluorescence
  • Primary Antibody Dilution: 1:50
  • Cell Tissue Type: Monolayer of MDA-MB-231 cells
FOLR1 Antibody Western Blot,Immunofluorescence validation (1:50 dilution) in Monolayer of MDA-MB-231 cells (Cat no:23355-1-AP)
Loading...
||
New chat

Able™

正在加载,请稍候...