FOXP1 Polyclonal antibody

FOXP1 Polyclonal Antibody for WB, IHC, FC (Intra), ELISA
Cat No. 22051-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, FC (Intra), ELISA

Mac-1-regulated forkhead, HSPC215, hFKH1B, Forkhead box protein P1, forkhead box P1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inJurkat cells, A549 cells, LNCaP cells, MCF-7 cells, MDA-MB-453s cells, mouse heart tissue, mouse lung tissue, mouse testis tissue, PC-3 cells, Raji cells, Y79 cells
Positive IHC detected inmouse embryo tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inJurkat cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:250-1:1000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

22051-1-AP targets FOXP1 in WB, IHC, IF, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag17045

Product name: Recombinant human FOXP1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 349-457 aa of BC131720

Sequence: QLELQLAKDKERLQAMMTHLHVKSTEPKAAPQPLNLVSSVTLSKSASEASPQSLPHTPTTPTAPLTPVTQGPSVITTTSMHTVGPIRRRYSDKYNVPISSADIAQNQEF

Predict reactive species
Full Name forkhead box P1
Calculated Molecular Weight 677 aa, 75 kDa
Observed Molecular Weight 50 kDa, 60-65 kDa, 85 kDa
GenBank Accession NumberBC131720
Gene Symbol FOXP1
Gene ID (NCBI) 27086
RRIDAB_2878980
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9H334
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FOXP1, also known as Mac-1-regulated forkhead, is a 677 amino acid protein, which forms homodimers and heterodimers with FOXP2 and FOXP4 (PubMed:25027557). Dimerization is required for DNA-binding. FOXP1 has an important function in neuronal development.9 Mutations of its gene, FOXP1, located on chromosome 3p14.1,7 can result in the development of autism spectrum disorder, intellectual disability, speech and language deficits as well as motor development delay. FOXP1 is also engaged in lung and esophagus morphogenesis, as well as in B-cell development.7,10 The widely researched role of FOXP1 in carcinogenesis is of great importance, although still unclear to some extent. FOXP1 exists some isoforms with MV 75-77 kDa, 65-67 kDa, 12 kDa.

Protocols

Product Specific Protocols
FC protocol for FOXP1 antibody 22051-1-APDownload protocol
IHC protocol for FOXP1 antibody 22051-1-APDownload protocol
WB protocol for FOXP1 antibody 22051-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
human,mouseWB

Int Immunopharmacol

Long non-coding RNA NEAT1 exacerbates NLRP3-mediated pyroptosis in allergic rhinitis through regulating the PTBP1/FOXP1 cascade

Authors - Yunliang Liu
humanWB

J Cell Mol Med

LINC01116 promotes proliferation and migration of endometrial stromal cells by targeting FOXP1 via sponging miR-9-5p in endometriosis.

Authors - Liangyi Cui
human,mouseWB,IF

J Neurochem

FOXP1 is a Transcription Factor for the Alzheimer's Disease Risk Gene SORL1

Authors - Xiaofeng Fu
  • KD Validated

bioRxiv

Temporally-segregated dual functions for Gfi1 in the development of retinal direction-selectivity

Authors - Karina Chaudhari
Loading...
||
New chat

Able

正在加载,请稍候...