CoraLite® Plus 488-conjugated FOXP1 Polyclonal antibody

FOXP1 Polyclonal Antibody for FC (Intra)
Cat No. CL488-22051

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

FC (Intra)

Mac-1-regulated forkhead, HSPC215, hFKH1B, Forkhead box protein P1, forkhead box P1

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inJurkat cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-22051 targets FOXP1 in FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag17045

Product name: Recombinant human FOXP1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 349-457 aa of BC131720

Sequence: QLELQLAKDKERLQAMMTHLHVKSTEPKAAPQPLNLVSSVTLSKSASEASPQSLPHTPTTPTAPLTPVTQGPSVITTTSMHTVGPIRRRYSDKYNVPISSADIAQNQEF

Predict reactive species
Full Name forkhead box P1
Calculated Molecular Weight 677 aa, 75 kDa
Observed Molecular Weight 50 kDa, 60-65 kDa, 85 kDa
GenBank Accession NumberBC131720
Gene Symbol FOXP1
Gene ID (NCBI) 27086
RRIDAB_3672739
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen Affinity Purified
UNIPROT IDQ9H334
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

FOXP1, also known as Mac-1-regulated forkhead, is a 677 amino acid protein, which forms homodimers and heterodimers with FOXP2 and FOXP4 (PubMed:25027557). Dimerization is required for DNA-binding. FOXP1 has an important function in neuronal development.9 Mutations of its gene, FOXP1, located on chromosome 3p14.1,7 can result in the development of autism spectrum disorder, intellectual disability, speech and language deficits as well as motor development delay. FOXP1 is also engaged in lung and esophagus morphogenesis, as well as in B-cell development.7,10 The widely researched role of FOXP1 in carcinogenesis is of great importance, although still unclear to some extent. FOXP1 exists some isoforms with MV 75-77 kDa, 65-67 kDa, 12 kDa.

Loading...
||
New chat Able
正在加载,请稍候...