FOXP1 Recombinant monoclonal antibody, PBS Only (Detector)

• 

  WB analysis using 86937-1-RR (same clone as 86937-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86937-1-RR (FOXP1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86937-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 86937-1-RR (same clone as 86937-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86937-1-RR (FOXP1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86937-1-PBS in a different storage buffer formulation.

• 

  Sandwich ELISA sample test of MP02841-1

  The mean FOXP1 concentration was determined to be 6.79 ng/mL in Jurkat cell extract based on a 1.2 mg/mL extract load and 10.88 ng/mL in A549 cell extract based on a 1.2 mg/mL extract load.

• 

  Sandwich ELISA standard curve of MP02841-1

  Sandwich ELISA standard curve of MP02841-1, Human FOXP1 Recombinant Matched Antibody Pair - PBS only. 86937-2-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag17045. 86937-1-PBS was HRP conjugated as the detection antibody. Range: 39.1-2500 pg/mL

• 

  IF Staining of Jurkat using 86937-1-RR (same clone as 86937-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed Jurkat cells using FOXP1 antibody (86937-1-RR, Clone: 243153D3 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 86937-1-PBS in a different storage buffer formulation.

• 

  ChIP experiment of Raji using 86937-1-RR (same clone as 86937-1-PBS)

  Chromatin was prepared from Raji cells. Cells were fixed with formaldehyde for 10 minutes. The ChIP was performed with 15 µg of cross-linked chromatin, 5 µg of FOXP1 (86937-1-RR) or 5 ug of Normal Rabbit IgG (98136-1-RR), and 20 µl of Protein A Magarose Beads. The immunoprecipitated DNA was quantified by real-time PCR. This data was developed using the same antibody clone with 86937-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 86937-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86937-1-RR against Human FOXP1 were performed. The affinity constant is 1.36 nM.

FOXP1 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Sandwich ELISA, Indirect ELISA, ChIP-qPCR

Cat No. 86937-1-PBS

Clone No.243153D3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Sandwich ELISA, Indirect ELISA, ChIP-qPCR

Synonyms

12CC4, forkhead box P1, Forkhead box protein P1, hFKH1B, HSPC215

---

Product Information

86937-1-PBS targets FOXP1 as part of a matched antibody pair:

MP02841-1: 86937-2-PBS capture and 86937-1-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag17045

  Product name: Recombinant human FOXP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 349-457 aa of BC131720

  Sequence: QLELQLAKDKERLQAMMTHLHVKSTEPKAAPQPLNLVSSVTLSKSASEASPQSLPHTPTTPTAPLTPVTQGPSVITTTSMHTVGPIRRRYSDKYNVPISSADIAQNQEF

• Full Name: forkhead box P1
• Calculated Molecular Weight: 677 aa, 75 kDa
• Observed Molecular Weight: 75-77 kDa, 65-67 kDa
• GenBank Accession Number: BC131720
• Gene Symbol: FOXP1
• Gene ID (NCBI): 27086
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9H334
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

FOXP1, also known as Mac-1-regulated forkhead, is a 677 amino acid protein, which forms homodimers and heterodimers with FOXP2 and FOXP4 (PubMed:25027557). Dimerization is required for DNA-binding. FOXP1 has an important function in neuronal development.9 Mutations of its gene, FOXP1, located on chromosome 3p14.1,7 can result in the development of autism spectrum disorder, intellectual disability, speech and language deficits as well as motor development delay. FOXP1 is also engaged in lung and esophagus morphogenesis, as well as in B-cell development.7,10 The widely researched role of FOXP1 in carcinogenesis is of great importance, although still unclear to some extent. FOXP1 exists some isoforms with MV 75-77 kDa, 65-67 kDa, 12 kDa.