FOXP1 Recombinant monoclonal antibody

• 

  WB analysis using 86937-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86937-1-RR (FOXP1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 86937-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86937-1-RR (FOXP1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of Jurkat using 86937-1-RR

  Immunofluorescent analysis of (4% PFA) fixed Jurkat cells using FOXP1 antibody (86937-1-RR, Clone: 243153D3 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• 

  ChIP experiment of Raji using 86937-1-RR

  Chromatin was prepared from Raji cells. Cells were fixed with formaldehyde for 10 minutes. The ChIP was performed with 15 µg of cross-linked chromatin, 5 µg of FOXP1 (86937-1-RR) or 5 ug of Normal Rabbit IgG (98136-1-RR), and 20 µl of Protein A Magarose Beads. The immunoprecipitated DNA was quantified by real-time PCR.

• 

  Affinity and Kinetic Characterization of 86937-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86937-1-RR against Human FOXP1 were performed. The affinity constant is 1.36 nM.

FOXP1 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, ELISA, ChIP-qPCR

Cat No. 86937-1-RR

Clone No.243153D3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA, ChIP-qPCR

Synonyms

12CC4, forkhead box P1, Forkhead box protein P1, hFKH1B, HSPC215

---

Tested Applications

• Positive WB detected in: Daudi cells, Raji cells, Jurkat cells
• Positive IF/ICC detected in: Jurkat cells
• Positive ChIP-qPCR detected in: Raji cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
• CHIP-QPCR: CHIP-QPCR : 1:10-1:100

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86937-1-RR targets FOXP1 in WB, IF/ICC, ELISA, ChIP-qPCR applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag17045

  Product name: Recombinant human FOXP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 349-457 aa of BC131720

  Sequence: QLELQLAKDKERLQAMMTHLHVKSTEPKAAPQPLNLVSSVTLSKSASEASPQSLPHTPTTPTAPLTPVTQGPSVITTTSMHTVGPIRRRYSDKYNVPISSADIAQNQEF

• Full Name: forkhead box P1
• Calculated Molecular Weight: 677 aa, 75 kDa
• Observed Molecular Weight: 75-77 kDa, 65-67 kDa
• GenBank Accession Number: BC131720
• Gene Symbol: FOXP1
• Gene ID (NCBI): 27086
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9H334
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FOXP1, also known as Mac-1-regulated forkhead, is a 677 amino acid protein, which forms homodimers and heterodimers with FOXP2 and FOXP4 (PubMed:25027557). Dimerization is required for DNA-binding. FOXP1 has an important function in neuronal development.9 Mutations of its gene, FOXP1, located on chromosome 3p14.1,7 can result in the development of autism spectrum disorder, intellectual disability, speech and language deficits as well as motor development delay. FOXP1 is also engaged in lung and esophagus morphogenesis, as well as in B-cell development.7,10 The widely researched role of FOXP1 in carcinogenesis is of great importance, although still unclear to some extent. FOXP1 exists some isoforms with MV 75-77 kDa, 65-67 kDa, 12 kDa.