FRZB Monoclonal antibody

• Home
• Products
• Primary Antibodies
• FRZB Monoclonal antibody (67081-1-Ig)

FRZB Monoclonal Antibody for WB, ELISA

Cat No. 67081-1-Ig Copied!

Clone No. 2B4A1

Publications (2)

Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

WB, ELISA
For FC, select conjugated version.

Synonyms

2B4A1, FIZ, FRE, Frezzled, FRITZ

• 

  WB analysis using 67081-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67081-1-Ig (FRZB antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of 4T1 using 67081-1-Ig

  4T1 cells were subjected to SDS PAGE followed by western blot with 67081-1-Ig (FRZB antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for FRZB in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: LNCaP cells, 4T1 cells, MKN-45 cells, SGC-7901 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67081-1-Ig targets FRZB in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28147

  Product name: Recombinant human FRZB protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 153-325 aa of BC027855

  Sequence: IVTADGADFPMDSSNGNCRGASSERCKCKPIRATQKTYFRNNYNYVIRAKVKEIKTKCHDVTAVVEVKEILKSSLVNIPRDTVNLYTSSGCLCPPLNVNEEYIIMGYEDEERSRLLLVEGSIAEKWKDRLGKKVKRWDMKLRHLGLSKSDSSNSDSTQSQKSGRNSNPRQARN

• Full Name: frizzled-related protein
• Calculated Molecular Weight: 325 aa, 36 kDa
• Observed Molecular Weight: 36 kDa
• GenBank Accession Number: BC027855
• Gene Symbol: FRZB
• Gene ID (NCBI): 2487
• RRID: AB_2882389
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q92765
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Frzb (also known as sFRP3) is a member of the secreted frizzled related protein (SFRP) family, originally identified as a chondrogenic factor during bone morphogenesis (PMID: 29209231). It was subsequently shown to be a regulator in Wnt signaling, and also have a role in regulating cell growth and differentiation in specific cell types. FRZB was seen to be acting as an oncogene in some cancer, such as metastatic renal cancer.

Publications

What published studies show

The FRZB Monoclonal antibody (2B4A1), catalog number 67081-1-Ig, has 2 total citations. These appear in European Journal of Pharmacology and Stem Cells Development. The cited research spans hematology/oncology (mesenchymal stromal cell proliferation in myelodysplastic syndromes) and stem cell biology (osteogenic differentiation of dental pulp stem cells via Wnt signaling). Both studies used the antibody for Western blot in human samples.

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Eur J Pharmacol; Eltrombopag restores proliferative capacity and adipose-osteogenic balance of mesenchymal stromal cells in low-risk myelodysplastic syndromes; Authors - Minghua Hong
human	WB	Stem Cells Dev; Chlorogenic Acid Promotes Osteogenic Differentiation of Human Dental Pulp Stem Cells Through Wnt Signaling.; Authors - Xiaoping Hu