FRZB Monoclonal antibody, PBS Only

• 

  WB analysis using 67081-1-Ig (same clone as 67081-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67081-1-Ig (FRZB antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67081-1-PBS in a different storage buffer formulation.

• 

  WB analysis of 4T1 using 67081-1-Ig (same clone as 67081-1-PBS)

  4T1 cells were subjected to SDS PAGE followed by western blot with 67081-1-Ig (FRZB antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67081-1-PBS in a different storage buffer formulation.

FRZB Monoclonal Antibody for WB, Indirect ELISA

Cat No. 67081-1-PBS

Clone No.2B4A1

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse

Applications

WB, Indirect ELISA

Synonyms

FIZ, FRE, Frezzled, FRITZ, frizzled related protein, Frizzled related protein 1, FRP, FRP 3, FRZB, FRZB 1, FRZB PEN, FRZB1, FZRB, hFIZ, sFRP 3, SFRP3, SRFP3

---

Product Information

67081-1-PBS targets FRZB in WB, Indirect ELISA applications and shows reactivity with Human, mouse samples.

• Tested Reactivity: Human, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28147

  Product name: Recombinant human FRZB protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 153-325 aa of BC027855

  Sequence: IVTADGADFPMDSSNGNCRGASSERCKCKPIRATQKTYFRNNYNYVIRAKVKEIKTKCHDVTAVVEVKEILKSSLVNIPRDTVNLYTSSGCLCPPLNVNEEYIIMGYEDEERSRLLLVEGSIAEKWKDRLGKKVKRWDMKLRHLGLSKSDSSNSDSTQSQKSGRNSNPRQARN

• Full Name: frizzled-related protein
• Calculated Molecular Weight: 325 aa, 36 kDa
• Observed Molecular Weight: 36 kDa
• GenBank Accession Number: BC027855
• Gene Symbol: FRZB
• Gene ID (NCBI): 2487
• RRID: AB_2882389
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q92765
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Frzb (also known as sFRP3) is a member of the secreted frizzled related protein (SFRP) family, originally identified as a chondrogenic factor during bone morphogenesis (PMID: 29209231). It was subsequently shown to be a regulator in Wnt signaling, and also have a role in regulating cell growth and differentiation in specific cell types. FRZB was seen to be acting as an oncogene in some cancer, such as metastatic renal cancer.