CoraLite® Plus 488-conjugated FRZB Monoclonal antibody

• 

  FC experiment of Neuro-2a using CL488-67081

  1X10^6 Neuro-2a cells were intracellularly stained with 0.4 ug CoraLite® Plus 488 Anti-Human FRZB (CL488-67081, Clone:2B4A1) (red), or 0.4 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

FRZB Monoclonal Antibody for FC (Intra)

Cat No. CL488-67081

Clone No.2B4A1

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

FC (Intra)

Synonyms

2B4A1, FIZ, FRE, Frezzled, FRITZ

---

Tested Applications

• Positive FC (Intra) detected in: Neuro-2a cells

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67081 targets FRZB in FC (Intra) applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28147

  Product name: Recombinant human FRZB protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 153-325 aa of BC027855

  Sequence: IVTADGADFPMDSSNGNCRGASSERCKCKPIRATQKTYFRNNYNYVIRAKVKEIKTKCHDVTAVVEVKEILKSSLVNIPRDTVNLYTSSGCLCPPLNVNEEYIIMGYEDEERSRLLLVEGSIAEKWKDRLGKKVKRWDMKLRHLGLSKSDSSNSDSTQSQKSGRNSNPRQARN

• Full Name: frizzled-related protein
• Calculated Molecular Weight: 325 aa, 36 kDa
• Observed Molecular Weight: 36 kDa
• GenBank Accession Number: BC027855
• Gene Symbol: FRZB
• Gene ID (NCBI): 2487
• RRID: AB_3084306
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q92765
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Frzb (also known as sFRP3) is a member of the secreted frizzled related protein (SFRP) family, originally identified as a chondrogenic factor during bone morphogenesis (PMID: 29209231). It was subsequently shown to be a regulator in Wnt signaling, and also have a role in regulating cell growth and differentiation in specific cell types. FRZB was seen to be acting as an oncogene in some cancer, such as metastatic renal cancer.