CoraLite®594-conjugated FSHR Polyclonal antibody

• 

• Featured Product
• KD/KO Validated

FSHR Polyclonal Antibody for

Cat No. CL594-22665

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

IHC, IF

Synonyms

LGR1, FSHRO, FSH-R, FSH R, Follitropin receptor

---

Published Applications

• IHC: See 1 publications below
• IF: See 2 publications below

Product Information

CL594-22665 targets FSHR in IHC, IF applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: duck
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18158

  Product name: Recombinant human FSHR protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 18-352 aa of BC118548

  Sequence: CHHRICHCSNRVFLCQESKVTEIPSDLPRNAIELRFVLTKLRVIQKGAFSGFGDLEKIEISQNDVLEVIEADVFSNLPKLHEIRIEKANNLLYINPEAFQNLPNLQYLLISNTGIKHLPDVHKIHSLQKVLLDIQDNINIHTIERNSFVGLSFESVILWLNKNGIQEIHNCAFNGTQLDELNLSDNNNLEELPNDVFHGASGPVILDISRTRIHSLPSYGLENLKKLRARSTYNLKKLPTLEKLVALMEASLTYPSHCCAFANWRRQISELHPICNKSILRQEVDYMTQTRGQRSSLAEDNESSYSRGFDMTYTEFDYDLCNEVVDVTCSPKPDA

• Full Name: follicle stimulating hormone receptor
• Calculated Molecular Weight: 695 aa, 78 kDa
• Observed Molecular Weight: 71-78 kDa
• GenBank Accession Number: BC118548
• Gene Symbol: FSHR
• Gene ID (NCBI): 2492
• RRID: AB_2883408
• Conjugate: CoraLite®594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 588 nm / 604 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P23945
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	IHC	Transl Res; Novel role of CXCL14 in modulating STAR expression in luteinized granulosa cells: implication for progesterone synthesis in PCOS patients.; Authors - Jia Qi
duck	IF	Front Microbiol; Dual Transcriptomic Analyses Unveil Host-Pathogen Interactions Between Salmonella enterica Serovar Enteritidis and Laying Ducks (Anas platyrhynchos).; Authors - Yu Zhang
	IF	Front Vet Sci; Identification of Differentially Expressed Non-coding RNA Networks With Potential Immunoregulatory Roles During Salmonella Enteritidis Infection in Ducks.; Authors - Yu Zhang