CoraLite®488-conjugated FSHR Polyclonal antibody

• 

  FC experiment of HeLa using CL488-22665

  1x10^6 HeLa cells were intracellularly stained with 0.4 ug CoraLite®488-conjugated FSHR Polyclonal antibody (CL488-22665)(red), or 0.4 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C).

• Featured Product
• KD/KO Validated

FSHR Polyclonal Antibody for FC (Intra)

Cat No. CL488-22665

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC (Intra)

Synonyms

Follicle-stimulating hormone receptor, Follitropin receptor, FSH R, FSH-R, FSHRO

---

Tested Applications

• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-22665 targets FSHR in FC (Intra) applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18158

  Product name: Recombinant human FSHR protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 18-352 aa of BC118548

  Sequence: CHHRICHCSNRVFLCQESKVTEIPSDLPRNAIELRFVLTKLRVIQKGAFSGFGDLEKIEISQNDVLEVIEADVFSNLPKLHEIRIEKANNLLYINPEAFQNLPNLQYLLISNTGIKHLPDVHKIHSLQKVLLDIQDNINIHTIERNSFVGLSFESVILWLNKNGIQEIHNCAFNGTQLDELNLSDNNNLEELPNDVFHGASGPVILDISRTRIHSLPSYGLENLKKLRARSTYNLKKLPTLEKLVALMEASLTYPSHCCAFANWRRQISELHPICNKSILRQEVDYMTQTRGQRSSLAEDNESSYSRGFDMTYTEFDYDLCNEVVDVTCSPKPDA

• Full Name: follicle stimulating hormone receptor
• Calculated Molecular Weight: 695 aa, 78 kDa
• Observed Molecular Weight: 71-78 kDa
• GenBank Accession Number: BC118548
• Gene Symbol: FSHR
• Gene ID (NCBI): 2492
• RRID: AB_3672748
• Conjugate: CoraLite®488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 491 nm / 516 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P23945
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

FSHR, also named as LGR1, belongs to the G-protein coupled receptor 1 family and FSH/LSH/TSH subfamily. FSHR is a receptor for follicle-stimulating hormone. The activity of this receptor is mediated by G proteins which activate adenylate cyclase. Defects in FSHR are a cause of ovarian dysgenesis type 1 (ODG1). Defects in FSHR are a cause of ovarian hyperstimulation syndrome (OHSS). This antibody is specific to FSHR.