FSHR Polyclonal antibody

• Home
• Products
• Primary Antibodies
• FSHR Polyclonal antibody (22665-1-AP)

• Featured Product
• KD/KO Validated

FSHR Polyclonal Antibody for WB, IHC, ELISA

Cat No. 22665-1-AP Copied!

Publications (131)

Reviews (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (6)

Applications

WB, IHC, ELISA

Synonyms

Follicle-stimulating hormone receptor, Follitropin receptor, FSH R, FSH-R, FSHRO

• 

  WB analysis using 22665-1-AP

  mouse ovary tissue were subjected to SDS PAGE followed by western blot with 22665-1-AP (FSHR antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 22665-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 22665-1-AP (FSHR antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 22665-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 22665-1-AP (FSHR antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of DU 145 using 22665-1-AP

  DU 145 cells were subjected to SDS PAGE followed by western blot with 22665-1-AP (FSHR antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of PC-3 using 22665-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 22665-1-AP (FSHR antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat ovary using 22665-1-AP

  rat ovary tissue were subjected to SDS PAGE followed by western blot with 22665-1-AP (FSHR antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse ovary using 22665-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse ovary tissue slide using 22665-1-AP (FSHR antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse ovary using 22665-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse ovary tissue slide using 22665-1-AP (FSHR antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for FSHR in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse ovary tissue, DU 145 cells, HeLa cells, PC-3 cells, rat ovary tissue
• Positive IHC detected in: mouse ovary tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

22665-1-AP targets FSHR in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, pig, chicken, goat, sheep, ovis aries (sheep), cat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18158

  Product name: Recombinant human FSHR protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 18-352 aa of BC118548

  Sequence: CHHRICHCSNRVFLCQESKVTEIPSDLPRNAIELRFVLTKLRVIQKGAFSGFGDLEKIEISQNDVLEVIEADVFSNLPKLHEIRIEKANNLLYINPEAFQNLPNLQYLLISNTGIKHLPDVHKIHSLQKVLLDIQDNINIHTIERNSFVGLSFESVILWLNKNGIQEIHNCAFNGTQLDELNLSDNNNLEELPNDVFHGASGPVILDISRTRIHSLPSYGLENLKKLRARSTYNLKKLPTLEKLVALMEASLTYPSHCCAFANWRRQISELHPICNKSILRQEVDYMTQTRGQRSSLAEDNESSYSRGFDMTYTEFDYDLCNEVVDVTCSPKPDA

• Full Name: follicle stimulating hormone receptor
• Calculated Molecular Weight: 695 aa, 78 kDa
• Observed Molecular Weight: 71-78 kDa
• GenBank Accession Number: BC118548
• Gene Symbol: FSHR
• Gene ID (NCBI): 2492
• RRID: AB_2631204
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P23945
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The FSHR polyclonal antibody (Cat# 22665-1-AP) has 131 citations published across journals including Nature Communications, Science Advances, Advanced Science, Theranostics, Redox Biology, Cell Death Discovery, Human Reproduction, Stem Cell Research & Therapy, Journal of Ovarian Research, Ecotoxicology and Environmental Safety, and Theriogenology. Associated research fields include ovarian follicular development, premature ovarian insufficiency, PCOS, granulosa cell biology, environmental toxicology, stem cell/exosome therapies, traditional Chinese medicine, epigenetic regulation, oxidative stress and ferroptosis, animal reproduction, and neurodegeneration.

Automatically generated from the 131 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse,human	WB	Autophagy; Autophagy regulates differentiation of ovarian granulosa cells through degradation of WT1; Authors - Tong Shao
		Nat Commun; Fosl2 facilitates chromatin accessibility to determine developmental events during follicular maturation; Authors - Hongyong Zhang
mouse	WB	J Adv Res; Core fucosylation regulates the ovarian response via FSH receptor during follicular development; Authors - Tiantong Wang
mouse	IHC	Redox Biol; Novel ovarian endometriosis model causes infertility via iron-mediated oxidative stress in mice.; Authors - Shotaro Hayashi
mouse,human	WB,IHC	Theranostics; FSH induces EMT in ovarian cancer via ALKBH5-regulated Snail m6A demethylation; Authors - Xingyan Xu
human		Adv Sci (Weinh); HIGD1A Alleviates Oxidative Stress Related Ovarian Hypofunction by Enhancing Granulosa Cell Functions via NF-κB/SOD2 Signaling Pathway; Authors - Huiying Li

Reviews

5.0 out of 5

1 verified customer reviews

What customers say

One reviewer (Nolan Beatty, April 2022) rated this antibody 5/5 stars for Western Blot at a 1:500 dilution on Mouse FSHR tissue (lot 00101757). They noted that the antibody performs better when staining at room temperature for 2 hours rather than at 4°C overnight, suggesting that adjusting the incubation conditions can improve signal quality.

Automatically generated from the 1 verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Nolan (Verified Customer) (04-11-2022)

Antibody works better if you stain at room temperature for 2 hours instead of 4C overnight.

• Applications: Western Blot
• Primary Antibody Dilution: 1:500
• Cell Tissue Type: Mouse FSHR