FTCD Monoclonal antibody

• Home
• Products
• Primary Antibodies
• FTCD Monoclonal antibody (66979-1-Ig)

• Featured Product
• KD/KO Validated

FTCD Monoclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 66979-1-Ig Copied!

Clone No. 1H8A1

Publications (1)

Download datasheet

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF-P, ELISA

Synonyms

Formimidoyltetrahydrofolate cyclodeaminase, Formimidoyltransferase-cyclodeaminase, Formiminotransferase-cyclodeaminase, Glutamate formimidoyltransferase, Glutamate formiminotransferase

• 

  WB analysis of mouse liver using 66979-1-Ig

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 66979-1-Ig (FTCD antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of pig kidney using 66979-1-Ig

  pig kidney tissue were subjected to SDS PAGE followed by western blot with 66979-1-Ig (FTCD antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of pig liver using 66979-1-Ig

  pig liver tissue were subjected to SDS PAGE followed by western blot with 66979-1-Ig (FTCD antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat liver using 66979-1-Ig

  rat liver tissue were subjected to SDS PAGE followed by western blot with 66979-1-Ig (FTCD antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 66979-1-Ig

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 66979-1-Ig (FTCD antibody) at dilution of 1:300 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 66979-1-Ig

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 66979-1-Ig (FTCD antibody) at dilution of 1:300 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 66979-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66979-1-Ig (FTCD antibody) at dilution of 1:300 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 66979-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66979-1-Ig (FTCD antibody) at dilution of 1:300 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of human liver cancer using 66979-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed human liver cancer tissue using FTCD antibody (66979-1-Ig, Clone: 1H8A1 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of human liver cancer using 66979-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed human liver cancer tissue using FTCD antibody (66979-1-Ig, Clone: 1H8A1 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse kidney using 66979-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse kidney tissue using FTCD antibody (66979-1-Ig, Clone: 1H8A1 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for FTCD in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse liver tissue, pig kidney tissue, pig liver tissue, rat liver tissue
• Positive IHC detected in: human kidney tissue, human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: human liver cancer tissue, mouse kidney tissue

Recommended dilution

• Western Blot (WB): WB : 1:3000-1:10000
• Immunohistochemistry (IHC): IHC : 1:150-1:600
• Immunofluorescence (IF)-P: IF-P : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

66979-1-Ig targets FTCD in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Cited Reactivity: mouse
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17429

  Product name: Recombinant human FTCD protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 192-541 aa of BC136395

  Sequence: TKEQAHRIALNLREQGRGKDQPGRLKKVQGIGWYLDEKNLAQVSTNLLDFEVTALHTVYEETCREAQELSLPVVGSQLVGLVPLKALLDAAAFYCEKENLFILEEEQRIRLVVSRLGLDSLCPFSPKERIIEYLVPERGPERGLGSKSLRAFVGEVGARSAAPGGGSVAAAAAAMGAALGSMVGLMTYGRRQFQSLDTTMRRLIPPFREASAKLTTLVDADAEAFTAYLEAMRLPKNTPEEKDRRTAALQEGLRRAVSVPLTLAETVASLWPALQELARCGNLACRSDLQVAAKALEMGVFGAYFNVLINLRDITDEAFKDQIHHRVSSLLQEAKTQAALVLDCLETRQE

• Full Name: formiminotransferase cyclodeaminase
• Calculated Molecular Weight: 541 aa, 59 kDa
• Observed Molecular Weight: 53-62 kDa
• GenBank Accession Number: BC136395
• Gene Symbol: FTCD
• Gene ID (NCBI): 10841
• RRID: AB_2882299
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O95954
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FTCD (formimidoyltransferase cyclodeaminase) is critical for the catabolism of histidine. This process is one-carbon units that can enter the one-carbon/folate cycle, which provides methyl groups for arsenic metabolism (PMID: 30893314). In addition, FTCD could serve as a predictive and prognostic marker for patients with HCC (PMID: 37675273).

Publications

What published studies show

The FTCD Monoclonal antibody (1H8A1), catalog number 66979-1-Ig, has 1 citation. It was published in Biomolecules (2023), in a study investigating exosome-related FTCD's role in M1 macrophage polarization and its impact on hepatocellular carcinoma prognosis. The research field encompasses cancer biology, specifically liver cancer, and immune cell biology.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Biomolecules; Exosome-Related FTCD Facilitates M1 Macrophage Polarization and Impacts the Prognosis of Hepatocellular Carcinoma; Authors - Youyi Liu ; KD Validated