FTCD Monoclonal antibody

• 

  WB analysis of mouse liver using 66979-1-Ig

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 66979-1-Ig (FTCD antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of pig kidney using 66979-1-Ig

  pig kidney tissue were subjected to SDS PAGE followed by western blot with 66979-1-Ig (FTCD antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of pig liver using 66979-1-Ig

  pig liver tissue were subjected to SDS PAGE followed by western blot with 66979-1-Ig (FTCD antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat liver using 66979-1-Ig

  rat liver tissue were subjected to SDS PAGE followed by western blot with 66979-1-Ig (FTCD antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human kidney using 66979-1-Ig

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 66979-1-Ig (FTCD antibody) at dilution of 1:300 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human kidney using 66979-1-Ig

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 66979-1-Ig (FTCD antibody) at dilution of 1:300 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 66979-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66979-1-Ig (FTCD antibody) at dilution of 1:300 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 66979-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66979-1-Ig (FTCD antibody) at dilution of 1:300 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of human liver cancer using 66979-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed human liver cancer tissue using FTCD antibody (66979-1-Ig, Clone: 1H8A1 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

• 

  IF Staining of human liver cancer using 66979-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed human liver cancer tissue using FTCD antibody (66979-1-Ig, Clone: 1H8A1 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

• 

  IF Staining of mouse kidney using 66979-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse kidney tissue using FTCD antibody (66979-1-Ig, Clone: 1H8A1 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

FTCD Monoclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 66979-1-Ig

Clone No.1H8A1

Publications(1)

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF-P, ELISA

Synonyms

Formimidoyltetrahydrofolate cyclodeaminase, Formimidoyltransferase-cyclodeaminase, Formiminotransferase-cyclodeaminase, Glutamate formimidoyltransferase, Glutamate formiminotransferase

---

Tested Applications

• Positive WB detected in: mouse liver tissue, pig kidney tissue, pig liver tissue, rat liver tissue
• Positive IHC detected in: human kidney tissue, human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: human liver cancer tissue, mouse kidney tissue

Recommended dilution

• Western Blot (WB): WB : 1:3000-1:10000
• Immunohistochemistry (IHC): IHC : 1:150-1:600
• Immunofluorescence (IF)-P: IF-P : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 1 publications below

Product Information

66979-1-Ig targets FTCD in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Cited Reactivity: mouse
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17429

  Product name: Recombinant human FTCD protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 192-541 aa of BC136395

  Sequence: TKEQAHRIALNLREQGRGKDQPGRLKKVQGIGWYLDEKNLAQVSTNLLDFEVTALHTVYEETCREAQELSLPVVGSQLVGLVPLKALLDAAAFYCEKENLFILEEEQRIRLVVSRLGLDSLCPFSPKERIIEYLVPERGPERGLGSKSLRAFVGEVGARSAAPGGGSVAAAAAAMGAALGSMVGLMTYGRRQFQSLDTTMRRLIPPFREASAKLTTLVDADAEAFTAYLEAMRLPKNTPEEKDRRTAALQEGLRRAVSVPLTLAETVASLWPALQELARCGNLACRSDLQVAAKALEMGVFGAYFNVLINLRDITDEAFKDQIHHRVSSLLQEAKTQAALVLDCLETRQE

• Full Name: formiminotransferase cyclodeaminase
• Calculated Molecular Weight: 541 aa, 59 kDa
• Observed Molecular Weight: 53-62 kDa
• GenBank Accession Number: BC136395
• Gene Symbol: FTCD
• Gene ID (NCBI): 10841
• RRID: AB_2882299
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O95954
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FTCD (formimidoyltransferase cyclodeaminase) is critical for the catabolism of histidine. This process is one-carbon units that can enter the one-carbon/folate cycle, which provides methyl groups for arsenic metabolism (PMID: 30893314). In addition, FTCD could serve as a predictive and prognostic marker for patients with HCC (PMID: 37675273).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Biomolecules; Exosome-Related FTCD Facilitates M1 Macrophage Polarization and Impacts the Prognosis of Hepatocellular Carcinoma; Authors - Youyi Liu ; KD Validated