Filter: AllWBIHCIF-P

WB analysis of mouse liver using 66979-1-Ig (same clone as 66979-1-PBS)
mouse liver tissue were subjected to SDS PAGE followed by western blot with 66979-1-Ig (FTCD antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66979-1-PBS in a different storage buffer formulation.
WB analysis of pig kidney using 66979-1-Ig (same clone as 66979-1-PBS)
pig kidney tissue were subjected to SDS PAGE followed by western blot with 66979-1-Ig (FTCD antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66979-1-PBS in a different storage buffer formulation.
WB analysis of pig liver using 66979-1-Ig (same clone as 66979-1-PBS)
pig liver tissue were subjected to SDS PAGE followed by western blot with 66979-1-Ig (FTCD antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66979-1-PBS in a different storage buffer formulation.
WB analysis of rat liver using 66979-1-Ig (same clone as 66979-1-PBS)
rat liver tissue were subjected to SDS PAGE followed by western blot with 66979-1-Ig (FTCD antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66979-1-PBS in a different storage buffer formulation.
IHC staining of human kidney using 66979-1-Ig (same clone as 66979-1-PBS)
Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 66979-1-Ig (FTCD antibody) at dilution of 1:300 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66979-1-PBS in a different storage buffer formulation.
IHC staining of human kidney using 66979-1-Ig (same clone as 66979-1-PBS)
Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 66979-1-Ig (FTCD antibody) at dilution of 1:300 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66979-1-PBS in a different storage buffer formulation.
IHC staining of human liver cancer using 66979-1-Ig (same clone as 66979-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66979-1-Ig (FTCD antibody) at dilution of 1:300 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66979-1-PBS in a different storage buffer formulation.
IHC staining of human liver cancer using 66979-1-Ig (same clone as 66979-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66979-1-Ig (FTCD antibody) at dilution of 1:300 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66979-1-PBS in a different storage buffer formulation.
IF Staining of human liver cancer using 66979-1-Ig (same clone as 66979-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed human liver cancer tissue using FTCD antibody (66979-1-Ig, Clone: 1H8A1 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66979-1-PBS in a different storage buffer formulation.
IF Staining of human liver cancer using 66979-1-Ig (same clone as 66979-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed human liver cancer tissue using FTCD antibody (66979-1-Ig, Clone: 1H8A1 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66979-1-PBS in a different storage buffer formulation.
IF Staining of mouse kidney using 66979-1-Ig (same clone as 66979-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse kidney tissue using FTCD antibody (66979-1-Ig, Clone: 1H8A1 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66979-1-PBS in a different storage buffer formulation.

Featured Product
KD/KO Validated

FTCD Monoclonal antibody, PBS Only

FTCD Monoclonal Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 66979-1-PBS

Clone No.1H8A1

Review Product

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF-P, Indirect ELISA

Synonyms

Formimidoyltetrahydrofolate cyclodeaminase, Formimidoyltransferase-cyclodeaminase, Formiminotransferase-cyclodeaminase, Glutamate formimidoyltransferase, Glutamate formiminotransferase

Formulation: PBS Only

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

66979-1-PBS targets FTCD in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity	human, mouse, rat, pig
Host / Isotype	Mouse / IgG2b
Class	Monoclonal
Type	Antibody
Immunogen	CatNo: Ag17429 Product name: Recombinant human FTCD protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 192-541 aa of BC136395 Sequence: TKEQAHRIALNLREQGRGKDQPGRLKKVQGIGWYLDEKNLAQVSTNLLDFEVTALHTVYEETCREAQELSLPVVGSQLVGLVPLKALLDAAAFYCEKENLFILEEEQRIRLVVSRLGLDSLCPFSPKERIIEYLVPERGPERGLGSKSLRAFVGEVGARSAAPGGGSVAAAAAAMGAALGSMVGLMTYGRRQFQSLDTTMRRLIPPFREASAKLTTLVDADAEAFTAYLEAMRLPKNTPEEKDRRTAALQEGLRRAVSVPLTLAETVASLWPALQELARCGNLACRSDLQVAAKALEMGVFGAYFNVLINLRDITDEAFKDQIHHRVSSLLQEAKTQAALVLDCLETRQE Predict reactive species
Full Name	formiminotransferase cyclodeaminase
Calculated Molecular Weight	541 aa, 59 kDa
Observed Molecular Weight	53-62 kDa
GenBank Accession Number	BC136395
Gene Symbol	FTCD
Gene ID (NCBI)	10841
RRID	AB_2882299
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	O95954
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

FTCD (formimidoyltransferase cyclodeaminase) is critical for the catabolism of histidine. This process is one-carbon units that can enter the one-carbon/folate cycle, which provides methyl groups for arsenic metabolism (PMID: 30893314). In addition, FTCD could serve as a predictive and prognostic marker for patients with HCC (PMID: 37675273).