Tested Applications
| Positive WB detected in | A549 cells, MDA-MB-231 cells, Caco-2 cells, HEK-293 cells, HeLa cells, HEK-293T cells, SH-SY5Y cells |
| Positive IHC detected in | human liver cancer tissue, human breast cancer tissue, human colon tissue, human stomach cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human lymphoma tissue, human liver cancer tissue |
| Positive FC (Intra) detected in | SH-SY5Y cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:3000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
27226-1-AP targets FTO in WB, IHC, IF-P, FC (Intra), IP, CoIP, RIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, rat, pig, monkey, chicken, hamster, goat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26095 Product name: Recombinant human FTO protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 400-505 aa of NM_001080432 Sequence: MAQLEALWKKMEGVTNAVLHEVKREGLPVEQRNEILTAILASLTARQNLRREWHARCQSRIARTLPADQKPECRPYWEKDDASMPLPFDLTDIVSELRGQLLEAKP Predict reactive species |
| Full Name | fat mass and obesity associated |
| Calculated Molecular Weight | 58 kDa |
| Observed Molecular Weight | 58 kDa |
| GenBank Accession Number | NM_001080432 |
| Gene Symbol | FTO |
| Gene ID (NCBI) | 79068 |
| RRID | AB_2880809 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9C0B1 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Fat mass and obesity-associated protein (FTO) has efficient oxidative demethylation activity targeting the abundant N6-methyladenosine (m6A) residues in RNA in vitro. Variants in the FTO (fat mass and obesity associated) gene are associated with increased body mass index in humans.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for FTO antibody 27226-1-AP | Download protocol |
| IF protocol for FTO antibody 27226-1-AP | Download protocol |
| IHC protocol for FTO antibody 27226-1-AP | Download protocol |
| WB protocol for FTO antibody 27226-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Genet N6-Methyladenosine co-transcriptionally directs the demethylation of histone H3K9me2.
| ||
Nat Cell Biol The piRNA CHAPIR regulates cardiac hypertrophy by controlling METTL3-dependent N6-methyladenosine methylation of Parp10 mRNA. | ||
Nat Commun Overcoming therapeutic resistance in oncolytic herpes virotherapy by targeting IGF2BP3-induced NETosis in malignant glioma | ||
Mol Cell mTORC1 stimulates cell growth through SAM synthesis and m6A mRNA-dependent control of protein synthesis. | ||
Adv Sci (Weinh) PXR Activation Relieves Deoxynivalenol-Induced Liver Oxidative Stress Via Malat1 LncRNA m6A Demethylation |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Xiaochen (Verified Customer) (07-08-2024) | Show good sepecific image in WB without non-specific bend.
![]() |
FH Katherine (Verified Customer) (09-25-2023) | Quality was good.
|
FH S (Verified Customer) (03-20-2023) | Very Good
![]() |
FH SU (Verified Customer) (03-22-2022) |
![]() |
FH P. (Verified Customer) (05-15-2021) | Excellent antibody!
![]() |







































