Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

FTO Polyclonal antibody

FTO Polyclonal Antibody for WB, IHC, IF-P, FC (Intra), ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human and More (8)

Applications

WB, IHC, IF-P, FC (Intra), IP, CoIP, ChIP, RIP, ELISA

KIAA1752

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for FTO in ?

Tested Applications

Positive WB detected inA549 cells, MDA-MB-231 cells, Caco-2 cells, HEK-293 cells, HeLa cells, HEK-293T cells, SH-SY5Y cells
Positive IHC detected inhuman liver cancer tissue, human breast cancer tissue, human colon tissue, human stomach cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman lymphoma tissue, human liver cancer tissue
Positive FC (Intra) detected inSH-SY5Y cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:3000
Immunohistochemistry (IHC)IHC : 1:200-1:800
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

27226-1-AP targets FTO in WB, IHC, IF-P, FC (Intra), IP, CoIP, ChIP, RIP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse, rat, pig, monkey, chicken, bovine, hamster, goat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag26095

Product name: Recombinant human FTO protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 400-505 aa of NM_001080432

Sequence: MAQLEALWKKMEGVTNAVLHEVKREGLPVEQRNEILTAILASLTARQNLRREWHARCQSRIARTLPADQKPECRPYWEKDDASMPLPFDLTDIVSELRGQLLEAKP

Predict reactive species
Full Name fat mass and obesity associated
Calculated Molecular Weight 58 kDa
Observed Molecular Weight 58 kDa
GenBank Accession NumberNM_001080432
Gene Symbol FTO
Gene ID (NCBI) 79068
RRIDAB_2880809
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9C0B1
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Fat mass and obesity-associated protein (FTO) has efficient oxidative demethylation activity targeting the abundant N6-methyladenosine (m6A) residues in RNA in vitro. Variants in the FTO (fat mass and obesity associated) gene are associated with increased body mass index in humans.

Protocols

Product Specific Protocols
FC protocol for FTO antibody 27226-1-APDownload protocol
IF protocol for FTO antibody 27226-1-APDownload protocol
IHC protocol for FTO antibody 27226-1-APDownload protocol
WB protocol for FTO antibody 27226-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

FTO Polyclonal antibody (Cat# 27226-1-AP) has accumulated 284 citations. Publications span high-impact journals including Nature, Science, Nat Commun, Nat Genet, EMBO J, Mol Cell, PNAS, Cell Rep, Sci Transl Med, J Clin Invest, and numerous others. Key research fields include m6A RNA epitranscriptomics, oncology, cardiovascular disease, neurodegeneration, metabolic disorders (diabetes/obesity), inflammation, ferroptosis, and developmental biology. FTO is predominantly studied as a central m6A demethylase regulating gene expression across these contexts.

SpeciesApplicationTitle
humanWB

Nature

A druggable copper-signalling pathway that drives inflammation

Authors - Stéphanie Solier
mouseWB

Science

Liver ALKBH5 regulates glucose and lipid homeostasis independently through GCGR and mTORC1 signaling

Authors - Kaixin Ding
mouseWB,IHC

Mil Med Res

Downregulation of FTO aggravates osteoarthritis with obesity by erasing m(6)A methylation of PDP2.

Authors - Xu-Ying Sun
humanWB

Cancer Commun (Lond)

Targeting histone deacetylase suppresses tumor growth through eliciting METTL14-modified m6 A RNA methylation in ocular melanoma

Authors - Ai Zhuang
humanWB

Nat Genet

N6-Methyladenosine co-transcriptionally directs the demethylation of histone H3K9me2.

Authors - Yuan Li
  • KO Validated
mouseWB,RIP

Nat Cell Biol

The piRNA CHAPIR regulates cardiac hypertrophy by controlling METTL3-dependent N6-methyladenosine methylation of Parp10 mRNA.

Authors - Xiang-Qian Gao

Reviews

    5.0 out of 5
Add a review

5 verified customer reviews

What customers say

All five reviews rate this antibody 5 stars for Western Blot. Users report strong specificity with clean bands and no non-specific binding across multiple cell lines including U2OS, HEK293T, AC16, and H9C2. A dilution of 1:1000 was noted as effective. Overall feedback consistently describes the product as high-quality and excellent for WB applications.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Xiaochen (Verified Customer) (07-08-2024)

Show good sepecific image in WB without non-specific bend.

  • Applications: Western Blot
  • Cell Tissue Type: U2OS
FTO Antibody Western Blot validation ( dilution) in U2OS (Cat no:27226-1-AP)

Katherine (Verified Customer) (09-25-2023)

Quality was good.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: HEK293T

S (Verified Customer) (03-20-2023)

Very Good

  • Applications: Western Blot
  • Primary Antibody Dilution: 1000
  • Cell Tissue Type: AC16
FTO Antibody Western Blot validation (1000 dilution) in AC16 (Cat no:27226-1-AP)

SU (Verified Customer) (03-22-2022)

  • Applications: Western Blot
  • Cell Tissue Type: H9C2
FTO Antibody Western Blot validation ( dilution) in H9C2 (Cat no:27226-1-AP)

P. (Verified Customer) (05-15-2021)

Excellent antibody!

  • Applications: Western Blot
  • Cell Tissue Type: H9C2
FTO Antibody Western Blot validation ( dilution) in H9C2 (Cat no:27226-1-AP)
Loading...
||
New chat

Able™

正在加载,请稍候...