Tested Applications
| Positive WB detected in | human kidney tissue, MOLT-4 cells |
| Positive IHC detected in | human pancreas cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:5000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 2 publications below |
| IHC | See 4 publications below |
| IF | See 2 publications below |
Product Information
11198-1-AP targets FXYD2 in WB, IHC, IF, ELISA applications and shows reactivity with human, rat samples.
| Tested Reactivity | human, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1676 Product name: Recombinant human FXYD2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-66 aa of BC013289 Sequence: MTGLSMDGGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRCGGNKKRRQINEDEP Predict reactive species |
| Full Name | FXYD domain containing ion transport regulator 2 |
| Calculated Molecular Weight | 7 kDa |
| Observed Molecular Weight | 7-10 kDa |
| GenBank Accession Number | BC013289 |
| Gene Symbol | FXYD2 |
| Gene ID (NCBI) | 486 |
| RRID | AB_2108309 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P54710 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
FXYD2 (FXYD domain-containing ion transport regulator 2), also known as the gamma-subunit of the NaK-ATPase, belongs to the FXYD family which has been proposed to be the regulators of Na, K-ATPase function by lowering affinities of the system for potassium and sodium. The expression of FXYD2 is most abundant in kidney, while it is also detected in several other tissues like placenta, pancreas, and dorsal root ganglia (DRGs). Three splice variants of FXYD2 have been reported in mouse kidney, namely FXYD2 γa, -γb,and -γc. FXYD2 γa has been identified as a pancreatic beta cell-specific biomarker. This antibody can recognize all three isoforms of FXYD2.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for FXYD2 antibody 11198-1-AP | Download protocol |
| WB protocol for FXYD2 antibody 11198-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Identification of stem cell populations in sweat glands and ducts reveals roles in homeostasis and wound repair. | ||
Front Cell Dev Biol A Na+/K+ ATPase Pump Regulates Chondrocyte Differentiation and Bone Length Variation in Mice. | ||
Nutrients Effect of Dapagliflozin and Magnesium Supplementation on Renal Magnesium Handling and Magnesium Homeostasis in Metabolic Syndrome. | ||
Brain Res Bull Microglial SIX2 suppresses lipopolysaccharide (LPS)-induced neuroinflammation by up-regulating FXYD2 expression | ||
Clin Transl Med Single-cell landscape of the intrahepatic ecosystem in alcohol-related liver disease |







