Tested Applications
| Positive FC detected in | mouse thymocytes |
Recommended dilution
| Application | Dilution |
|---|---|
| Flow Cytometry (FC) | FC : 0.25 ug per 10^6 cells in 100 μl suspension |
| This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL647-98135 targets Fas/CD95 in FC applications and shows reactivity with mouse samples.
| Tested Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg1376 Product name: Recombinant Mouse Fas/CD95 protein (rFc Tag) Source: mammalian cells-derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 22-169 aa of NM_007987.2 Sequence: QGTNSISESLKLRRRVRETDKNCSEGLYQGGPFCCQPCQPGKKKVEDCKMNGGTPTCAPCTEGKEYMDKNHYADKCRRCTLCDEEHGLEVETNCTLTQNTKCKCKPDFYCDSPGCEHCVRCASCEHGTLEPCTATSNTNCRKQSPRNR Predict reactive species |
| Full Name | Fas (TNF receptor superfamily member 6) |
| Calculated Molecular Weight | 37kDa |
| GenBank Accession Number | NM_007987.2 |
| Gene Symbol | Fas/CD95 |
| Gene ID (NCBI) | 14102 |
| Conjugate | CoraLite® Plus 647 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 654 nm / 674 nm |
| Excitation Laser | Red Laser (633 nm) |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P25446 |
| Storage Buffer | PBS with 0.09% sodium azide, pH 7.3. |
| Storage Conditions | Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment. |
Background Information
Fas (CD95/APO-1) is a transmembrane glycoprotein belonging to the tumor necrosis factor (TNF) receptor superfamily. It can mediate apoptosis by ligation with an agonistic anti-Fas antibody or Fas ligand. Stimulation of Fas results in the aggregation of its intracellular death domains, leading to the formation of the death-inducing signaling complex (DISC). FAS-mediated apoptosis may have a role in the induction of peripheral tolerance, in the antigen-stimulated suicide of mature T-cells, or both. The molecular mass of native Fas is 38 kDa, the high molecular weight form (40-55 kDa) of Fas is due to glycosylation.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for CL Plus 647 Fas/CD95 antibody CL647-98135 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



