• Featured Product
  • KD/KO Validated

G-CSF Polyclonal antibody

G-CSF Polyclonal Antibody for WB, FC (Intra), ELISA

Cat No. 17185-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, FC (Intra), ELISA

CSF3, C17orf33, CSF 3, FilgrastimLenograstim, GCSF

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HepG2 cells, MOLT-4 cells, MCF-7 cells, K-562 cells
Positive FC (Intra) detected inK-562 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

17185-1-AP targets G-CSF in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag10968

Product name: Recombinant human G-CSF protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-200 aa of BC033245

Sequence: MSPEPALSPALQLLLWHSALWTVQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP

Predict reactive species
Full Name colony stimulating factor 3 (granulocyte)
Calculated Molecular Weight 200 aa, 22 kDa
Observed Molecular Weight20 kDa
GenBank Accession NumberBC033245
Gene Symbol G-CSF
Gene ID (NCBI) 1440
RRIDAB_2878357
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP09919
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Granulocyte colony-stimulating factor (G-CSF), also referred to as CSF3, is a protective cytokine with anti-inflammatory effects. G-CSF is important in promoting survival of the granulocytic lineage cells and proliferation and migration of neutrophils as well as trophoblast cells. G-CSF acts by binding to its receptor G-CSFR (also called CSF3R), which after binding with G-CSF activates the canonical Janus kinase (Jak)/signal transducer, activator of transcription (STAT)and Ras/Raf/MAP kinase pathways. G-CSF potently stimulates the proliferation and release of peripheral blood progenitor cells into the bloodstream and is therefore used to treat neutropenia after chemotherapy. Furthermore, G-CSF levels are elevated upon intensive exercise leading to increased neutrophil counts, which are predominantly due to delayed neutrophil apoptosis.

Protocols

Product Specific Protocols
FC protocol for G-CSF antibody 17185-1-APDownload protocol
WB protocol for G-CSF antibody 17185-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIHC

Mol Immunol

Granulocyte colony stimulating factor (G-CSF) regulates neutrophils infiltration and periodontal tissue destruction in an experimental periodontitis.

Authors - Zheng Zhang
mouseWB

Discov Oncol

Inhibiting glycolysis facilitated checkpoint blockade therapy for triple-negative breast cancer

Authors - Chong Li
humanWB,IHC

Int J Mol Sci

A NOTCH1 Mutation Found in a Newly Established Ovarian Cancer Cell Line (FDOVL) Promotes Lymph Node Metastasis in Ovarian Cancer

Authors - Wei Jiang
  • KD Validated
Loading...
||
New chat

Able

正在加载,请稍候...