• Featured Product
  • KD/KO Validated

G3BP1 Polyclonal antibody

G3BP1 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Cat No. 13057-2-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (5)

Applications

WB, IHC, IF/ICC, FC (Intra), IP, CoIP, RIP, ELISA

ATP-dependent DNA helicase VIII, EC:3.6.4.12, G3BP, G3BP 1, G3BP-1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inC6 cells, HEK-293 cells, human brain tissue, Neuro-2a cells, Jurkat cells, MCF-7 cells, HeLa cells, mouse kidney tissue, rat kidney tissue, mouse brain tissue, rat brain tissue
Positive IP detected inHEK-293 cells
Positive IHC detected inhuman lung cancer tissue, human colon cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected insodium arsenite treated HeLa cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:16000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:1000-1:4000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

13057-2-AP targets G3BP1 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig, monkey, chicken, zebrafish, drosophila melanogaster (fruit fly)
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag3728

Product name: Recombinant human G3BP1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 167-466 aa of BC006997

Sequence: PDDSGTFYDQAVVSNDMEEHLEEPVAEPEPDPEPEPEQEPVSEIQEEKPEPVLEETAPEDAQKSSSPAPADIAQTVQEDLRTFSWASVTSKNLPPSGAVPVTGIPPHVVKVPASQPRPESKPESQIPPQRPQRDQRVREQRINIPPQRGPRPIREAGEQGDIEPRRMVRHPDSHQLFIGNLPHEVDKSELKDFFQSYGNVVELRINSGGKLPNFGFVVFDDSEPVQKVLSNRPIMFRGEVRLNVEEKKTRAAREGDRRDNRLRGPGGPRGGLGGGMRGPPRGGMVQKPGFGVGRGLAPRQ

Predict reactive species
Full Name GTPase activating protein (SH3 domain) binding protein 1
Calculated Molecular Weight 466 aa, 52 kDa
Observed Molecular Weight68 kDa
GenBank Accession NumberBC006997
Gene Symbol G3BP1
Gene ID (NCBI) 10146
RRIDAB_2232034
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ13283
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GAP SH3 Binding Protein 1 (G3BP1), also named as G3BP, is an effector of stress granule (SG) assembly. SG biology plays an important role in the pathophysiology of TDP-43 in ALS and FTLD-U. G3BP1 can be used as a marker of SG. It has been shown to function downstream of Ras and play a role in RNA metabolism, signal transduction, and proliferation. G3BP1 is a ubiquitously expressed protein that localizes to the cytoplasm in proliferating cells and to the nucleus in non-proliferating cells. G3BP1 has recently been implicated in cancer biology.

Protocols

Product Specific Protocols
FC protocol for G3BP1 antibody 13057-2-APDownload protocol
IF protocol for G3BP1 antibody 13057-2-APDownload protocol
IHC protocol for G3BP1 antibody 13057-2-APDownload protocol
IP protocol for G3BP1 antibody 13057-2-APDownload protocol
WB protocol for G3BP1 antibody 13057-2-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouse,human,chickenIF,CoIP

Cell

Diverse CMT2 neuropathies are linked to aberrant G3BP interactions in stress granules

Authors - Qinqin Cui
humanIF

Nature

m6A enhances the phase separation potential of mRNA.

Authors - Ryan J Ries
humanIP,IF

Science

Ubiquitination of G3BP1 mediates stress granule disassembly in a context-specific manner.

Authors - Youngdae Gwon
humanIF

Cell

ELAVL4, splicing, and glutamatergic dysfunction precede neuron loss in MAPT mutation cerebral organoids.

Authors - Kathryn R Bowles
humanIF

Cell

RNA Granules Hitchhike on Lysosomes for Long-Distance Transport, Using Annexin A11 as a Molecular Tether.

Authors - Ya-Cheng Liao
humanIF

Cell

Phase Separation of FUS Is Suppressed by Its Nuclear Import Receptor and Arginine Methylation.

Authors - Mario Hofweber

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Prakash (Verified Customer) (10-17-2025)

working very well in western blot

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:4000 for western
  • Cell Tissue Type: T24 Bladder cancer cell
FH

lu (Verified Customer) (09-18-2025)

Good antibody for flow cytometry

  • Applications: Flow Cytometry
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: OPM2
FH

Nikolett (Verified Customer) (07-29-2025)

Antibody works well for western blot in 1:1000 dilution, incubated overnight in 3%BSA/PBS on human lung cancer cell lines.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Human Lung Cancer Patient Derived Cell Lines
FH

Xiaochen (Verified Customer) (11-11-2024)

  • Applications: Immunofluorescence
G3BP1 Antibody Immunofluorescence validation ( dilution) in (Cat no:13057-2-AP)
FH

Xiaochen (Verified Customer) (11-11-2024)

  • Applications: Immunofluorescence
  • Cell Tissue Type: SH-SY5Y
G3BP1 Antibody Immunofluorescence validation ( dilution) in SH-SY5Y (Cat no:13057-2-AP)
FH

Roy (Verified Customer) (06-12-2024)

Works great on WB (1/1000 - Overnight 4°C) - Very beautiful IF staining in non stressed (diffuse staining) and Sodium Arsenite-mediated Stress induction (Punctate staining corresponding to stress granules) in HeLa cells (1/250 - 1h at RT).

  • Applications: Western Blot, Immunofluorescence
  • Primary Antibody Dilution: 1/1000
  • Cell Tissue Type: HeLa
FH

Vinny (Verified Customer) (02-20-2024)

Good product.

  • Applications: Immunofluorescence
FH

Andrea (Verified Customer) (10-05-2023)

Good and strong signal.

  • Applications: Western Blot
FH

Tatyana (Verified Customer) (01-21-2023)

Used for IP and WB of GFP-tagged overexpressed human G3BP1 (HEK293 cells). Lysates were subjected to IP using GFP-Trap beads. WB was done using semi-dry transfer. Antibody was used in 4% milk in TBST at 1:1,000 dilution. It could be reused up to 3 times. As the image shows, the antibody can successfully detect both endogenous and OE protein.

  • Applications: Immunofluorescence, Immunoprecipitation
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: HEK293
G3BP1 Antibody Immunofluorescence,Immunoprecipitation validation (1:1000 dilution) in HEK293 (Cat no:13057-2-AP)
FH

Tobias (Verified Customer) (10-25-2022)

  • Applications: Western Blot
FH

Peter (Verified Customer) (10-24-2022)

Best G3BP1 antibody I've used for Western, IF and IP

  • Applications: Western Blot, Immunofluorescence, Immunoprecipitation
  • Primary Antibody Dilution: 1:1000 for WB. 1:200 for IF
  • Cell Tissue Type: A549 and U2OS
FH

Patryk (Verified Customer) (03-18-2021)

I used the antibody for immunofluorescence imaging to label stress granules induced by treating the cells with with 50µM sodium arsenite. Used the antibody at a dilution 1:100 overnight at 4°C. Worked perfectly well, strong and specific signal. I am very satisfied of this antibody and strongly recommend if for immunofluorescence.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: HCT116 cells
G3BP1 Antibody Immunofluorescence validation (1:100 dilution) in HCT116 cells (Cat no:13057-2-AP)
FH

Kun (Verified Customer) (03-23-2020)

Very specific and sensitive

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
FH

Biao (Verified Customer) (03-11-2020)

This antibody is very specific and good quality.

  • Applications: Western Blot,
  • Cell Tissue Type: hct-116
FH

Joshua (Verified Customer) (12-28-2019)

PANC1 cells fixed in 4% paraformaldehdye. Bright localization to stress granules.

  • Applications: Immunofluorescence,
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: human pancreatic adenocarcinoma cells
G3BP1 Antibody Immunofluorescence, validation (1:500 dilution) in human pancreatic adenocarcinoma cells (Cat no:13057-2-AP)
FH

Yuan (Verified Customer) (11-02-2019)

Very bright staining for stress granule on NaAsO2 treated Hela cells. 1:500 should be sufficient for IF staining.

  • Applications: Immunofluorescence,
  • Primary Antibody Dilution: 1:250
  • Cell Tissue Type: Hela
G3BP1 Antibody Immunofluorescence, validation (1:250 dilution) in Hela (Cat no:13057-2-AP)
FH

Zeinab (Verified Customer) (08-19-2019)

It worked great

  • Applications: Immunofluorescence,
  • Primary Antibody Dilution: 1:400
FH

Erica (Verified Customer) (05-15-2019)

Our lab has been using this antibody for IP, WB and IF for many years and it always worked well. I highly recommend this antibody, especially for IP for stress granules.

  • Applications: Western Blot, Immunofluorescence, Immunoprecipitation,
  • Cell Tissue Type: HeLa; MEF
FH

Karthik (Verified Customer) (04-24-2019)

Upon induction of sodium arsenite stress in neurons G3BP1 positive stress granules formed in 90 minutes.Cells permeabilized with 0.2% triton for 10 minutes

  • Applications: Immunofluorescence,
  • Primary Antibody Dilution: 1: 500 overnight at 4 degrees
  • Cell Tissue Type: Primary motor neurons
G3BP1 Antibody Immunofluorescence, validation (1: 500 overnight at 4 degrees dilution) in Primary motor neurons (Cat no:13057-2-AP)
FH

Tian (Verified Customer) (01-23-2019)

I used it for ICC and it worked Great.

  • Applications: Immunofluorescence,
  • Primary Antibody Dilution: 1;100
  • Cell Tissue Type: NIH3T3
Loading...
||
New chat

Able

正在加载,请稍候...