Tested Applications
| Positive WB detected in | HepG2 cells, L02 cells, rat liver tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 2 publications below |
Product Information
25771-1-AP targets G6PC in WB, ELISA applications and shows reactivity with human, rat samples.
| Tested Reactivity | human, rat |
| Cited Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag22683 Product name: Recombinant human G6PC protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-62 aa of BC136369 Sequence: MEEGMNVLHDFGIQSTHYLQVNYQDSQDWFILVSVIADLRNAFYVLFPIWFHLQEAVGIKLL Predict reactive species |
| Full Name | glucose-6-phosphatase, catalytic subunit |
| Observed Molecular Weight | 42 kDa |
| GenBank Accession Number | BC136369 |
| Gene Symbol | G6PC |
| Gene ID (NCBI) | 2538 |
| RRID | AB_3669498 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P35575 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Glucose-6-phosphatase-α (G6PC) is a key enzyme in glucose homeostasis that catalyzes the hydrolysis of glucose-6-phosphate to glucose and phosphate in the terminal step of gluconeogenesis and glycogenolysis. G6PC activity is restricted to the liver, the kidney cortex, and the small intestine and confers on these three organs the capacity to release glucose into the systemic circulation (PMID: 21983240). The encoded enzyme is anchored to the ER by nine transmembrane helices with the amino (N)-terminus in the lumen and the carboxyl (C)-terminus in the cytoplasm (PMID: 15542400).
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for G6PC antibody 25771-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Int J Biol Macromol Structural characterization of Astragalus polysaccharide-D1 and its improvement of low-dose metformin effect by enriching Staphylococcus lentus | ||
J Nutr Biochem Fish oil-derived n-3 polyunsaturated fatty acids downregulate aquaporin 9 protein expression of liver and white adipose tissues in diabetic KK mice and 3T3-L1 adipocytes |

