Tested Applications
Positive WB detected in | HuH-7 cells, L02 cells, HepG2 cells |
Positive IHC detected in | human liver tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF-P detected in | mouse liver tissue |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:5000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 5 publications below |
Product Information
66860-1-Ig targets G6PC in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag17839 Product name: Recombinant human G6PC protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-60 aa of BC130478 Sequence: MEEGMNVLHDFGIQSTHYLQVNYQDSQDWFILVSVIADLRNAFYVLFPIWFHLQEAVGIK Predict reactive species |
Full Name | glucose-6-phosphatase, catalytic subunit |
Calculated Molecular Weight | 357 aa, 40 kDa |
Observed Molecular Weight | 37-42 kDa |
GenBank Accession Number | BC130478 |
Gene Symbol | G6PC |
Gene ID (NCBI) | 2538 |
RRID | AB_2882199 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein G purification |
UNIPROT ID | P35575 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Glucose-6-phosphatase-α (G6PC) is a key enzyme in glucose homeostasis that catalyzes the hydrolysis of glucose-6-phosphate to glucose and phosphate in the terminal step of gluconeogenesis and glycogenolysis. G6PC activity is restricted to the liver , the kidney cortex and the small intestine and confers on these three organs the capacity to release glucose into the systemic circulation (PMID: 21983240).The encoded enzyme is anchored to the ER by nine transmembrane helices with the amino (N)-terminus in the lumen and the carboxyl (C)-terminus in the cytoplasm (PMID: 15542400).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for G6PC antibody 66860-1-Ig | Download protocol |
IHC protocol for G6PC antibody 66860-1-Ig | Download protocol |
IF protocol for G6PC antibody 66860-1-Ig | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Front Pharmacol Berberrubine, a Main Metabolite of Berberine, Alleviates Non-Alcoholic Fatty Liver Disease via Modulating Glucose and Lipid Metabolism and Restoring Gut Microbiota | ||
Front Cell Dev Biol Single-cell and genetic multi-omics analysis combined with experiments confirmed the signature and potential targets of cuproptosis in hepatocellular carcinoma | ||
Sci Adv Atf3-mediated metabolic reprogramming in hepatic macrophage orchestrates metabolic dysfunction-associated steatohepatitis | ||
J Endocrinol Invest Lactobacillus murinus alleviates insulin resistance via promoting L-citrulline synthesis |