Tested Applications
| Positive WB detected in | HuH-7 cells, L02 cells, HepG2 cells |
| Positive IHC detected in | human liver tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:5000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66860-1-Ig targets G6PC in WB, IHC, IF, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag17839 Product name: Recombinant human G6PC protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-60 aa of BC130478 Sequence: MEEGMNVLHDFGIQSTHYLQVNYQDSQDWFILVSVIADLRNAFYVLFPIWFHLQEAVGIK Predict reactive species |
| Full Name | glucose-6-phosphatase, catalytic subunit |
| Calculated Molecular Weight | 357 aa, 40 kDa |
| Observed Molecular Weight | 37-42 kDa |
| GenBank Accession Number | BC130478 |
| Gene Symbol | G6PC |
| Gene ID (NCBI) | 2538 |
| RRID | AB_2882199 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P35575 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Glucose-6-phosphatase-α (G6PC) is a key enzyme in glucose homeostasis that catalyzes the hydrolysis of glucose-6-phosphate to glucose and phosphate in the terminal step of gluconeogenesis and glycogenolysis. G6PC activity is restricted to the liver , the kidney cortex and the small intestine and confers on these three organs the capacity to release glucose into the systemic circulation (PMID: 21983240).The encoded enzyme is anchored to the ER by nine transmembrane helices with the amino (N)-terminus in the lumen and the carboxyl (C)-terminus in the cytoplasm (PMID: 15542400).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for G6PC antibody 66860-1-Ig | Download protocol |
| WB protocol for G6PC antibody 66860-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The G6PC Monoclonal antibody (1E11A5), catalog number 66860-1-Ig, has 14 citations. These appear in journals including Science Advances, EMBO Reports, Biochemical Pharmacology, Diabetes, Obesity and Metabolism, Translational Research, International Immunopharmacology, Frontiers in Pharmacology, iScience, Journal of Ethnopharmacology, and others. Research fields span hepatic gluconeogenesis, metabolic dysfunction-associated steatohepatitis, type 2 diabetes, lipid metabolism, insulin resistance, hepatocellular carcinoma, acute kidney injury, and gut microbiota modulation.
| Species | Application | Title |
|---|---|---|
Sci Adv Atf3-mediated metabolic reprogramming in hepatic macrophage orchestrates metabolic dysfunction-associated steatohepatitis | ||
J Anim Sci Biotechnol Taurodeoxycholic, taurocholic, and glycocholic acids promote hepatic gluconeogenesis via TGR5 in dairy cows. | ||
Biochem Pharmacol Reynoutrin targets EphB4 to ameliorate hepatic glucose and lipid metabolic disorders in type 2 diabetes mellitus | ||
Transl Res Ticagrelor protects sepsis-associated acute kidney injury by modulating renal gluconeogenesis and inflammation through the P2Y12 receptor in proximal tubule cells. | ||
Int Immunopharmacol Ginsenoside Rh2 mitigates hepatic gluconeogenesis by regulating Akt/FoxO1 pathway in type 2 diabetic mice.
|
