G6PC Monoclonal antibody, PBS Only (Detector)

G6PC Monoclonal Antibody for WB, IHC, IF-P, Cytometric bead array, Indirect ELISA
Cat No. 66860-1-PBS
Clone No.1E11A5

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, IF-P, Cytometric bead array, Indirect ELISA

G6PC1, 1E11A5, EC:3.1.3.9, G6Pase, G-6-Pase

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66860-1-PBS targets G6PC as part of a matched antibody pair:

MP50826-2: 66860-4-PBS capture and 66860-1-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag17839

Product name: Recombinant human G6PC protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-60 aa of BC130478

Sequence: MEEGMNVLHDFGIQSTHYLQVNYQDSQDWFILVSVIADLRNAFYVLFPIWFHLQEAVGIK

Predict reactive species
Full Name glucose-6-phosphatase, catalytic subunit
Calculated Molecular Weight 357 aa, 40 kDa
Observed Molecular Weight 37-42 kDa
GenBank Accession NumberBC130478
Gene Symbol G6PC
Gene ID (NCBI) 2538
RRIDAB_2882199
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP35575
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Glucose-6-phosphatase-α (G6PC) is a key enzyme in glucose homeostasis that catalyzes the hydrolysis of glucose-6-phosphate to glucose and phosphate in the terminal step of gluconeogenesis and glycogenolysis. G6PC activity is restricted to the liver , the kidney cortex and the small intestine and confers on these three organs the capacity to release glucose into the systemic circulation (PMID: 21983240).The encoded enzyme is anchored to the ER by nine transmembrane helices with the amino (N)-terminus in the lumen and the carboxyl (C)-terminus in the cytoplasm (PMID: 15542400).

Loading...
||
New chat

Able

正在加载,请稍候...