Product Information
66458-1-PBS targets GABARAPL1 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig samples.
Tested Reactivity | human, mouse, rat, pig |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag1473 Product name: Recombinant human ATG8L protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-117 aa of BC009309 Sequence: MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK Predict reactive species |
Full Name | GABA(A) receptor-associated protein like 1 |
Calculated Molecular Weight | 14 kDa |
Observed Molecular Weight | 16-18 kDa |
GenBank Accession Number | BC009309 |
Gene Symbol | GABARAPL1 |
Gene ID (NCBI) | 23710 |
RRID | AB_2881827 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein G purification |
UNIPROT ID | Q9H0R8 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |
Background Information
GABARAPL1 (GABARAP-like protein 1), also named ATG8, GEC1, APG8L, ATG8L, and APG8-LIKE, is a member of the GABARP (GABAA receptor-associated protein) family. GABARAPL1 was initially identified as an estrogen-regulated gene and the protein acts in receptor and vesicle transport. It's also involved in the process of autophagy like GABARAP and GABARAPL2 and may be considered as an autophagic marker. It is expressed at very high levels in the brain, heart, peripheral blood leukocytes, liver, kidney, placenta, and skeletal muscle and at very low levels in the thymus and small intestine.