Tested Applications
| Positive WB detected in | mouse brain tissue, rat brain tissue, pig brain tissue |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:300-1:1200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 2 publications below |
| IF | See 2 publications below |
Product Information
66458-1-Ig targets GABARAPL1 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig samples.
| Tested Reactivity | human, mouse, rat, pig |
| Cited Reactivity | human |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1473 Product name: Recombinant human ATG8L protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-117 aa of BC009309 Sequence: MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK Predict reactive species |
| Full Name | GABA(A) receptor-associated protein like 1 |
| Calculated Molecular Weight | 14 kDa |
| Observed Molecular Weight | 16-18 kDa |
| GenBank Accession Number | BC009309 |
| Gene Symbol | GABARAPL1 |
| Gene ID (NCBI) | 23710 |
| RRID | AB_2881827 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q9H0R8 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
GABARAPL1 (GABARAP-like protein 1), also named ATG8, GEC1, APG8L, ATG8L, and APG8-LIKE, is a member of the GABARP (GABAA receptor-associated protein) family. GABARAPL1 was initially identified as an estrogen-regulated gene and the protein acts in receptor and vesicle transport. It's also involved in the process of autophagy like GABARAP and GABARAPL2 and may be considered as an autophagic marker. It is expressed at very high levels in the brain, heart, peripheral blood leukocytes, liver, kidney, placenta, and skeletal muscle and at very low levels in the thymus and small intestine.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for GABARAPL1 antibody 66458-1-Ig | Download protocol |
| WB protocol for GABARAPL1 antibody 66458-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
PLoS Pathog The mitophagy receptor NIX induces vIRF-1 oligomerization and interaction with GABARAPL1 for the promotion of HHV-8 reactivation-induced mitophagy | ||
Iran J Basic Med Sci Targeting GABARAPL1/HIF-2a axis to induce tumor cell apoptosis in nasopharyngeal carcinoma
| ||







