GABRA6 Polyclonal antibody, PBS Only

• 

  IHC staining of mouse cerebellum using 21766-1-AP (same clone as 21766-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 21766-1-AP (GABRA6 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21766-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse cerebellum using 21766-1-AP (same clone as 21766-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 21766-1-AP (GABRA6 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21766-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse cerebellum using 21766-1-AP (same clone as 21766-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse cerebellum tissue using GABRA6 antibody (21766-1-AP) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21766-1-PBS in a different storage buffer formulation.

GABRA6 Polyclonal Antibody for IHC, IF-P, Indirect ELISA

Cat No. 21766-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IF-P, Indirect ELISA

Synonyms

GABA A receptor alpha 6, GABA(A) receptor subunit alpha-6, GABAA receptor alpha 6, GABAAR subunit alpha-6, GABRA 6

---

Product Information

21766-1-PBS targets GABRA6 in IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16375

  Product name: Recombinant human GABRA6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 329-424 aa of BC096241

  Sequence: NLQTQKAKRKAQFAAPPTVTISKATEPLEAEIVLHPDSKYHLKKRITSLSLPIVSSSEANKVLTRAPILQSTPVTPPPLSPAFGGTSKIDQYSRIL

• Full Name: gamma-aminobutyric acid (GABA) A receptor, alpha 6
• Calculated Molecular Weight: 453 aa, 51 kDa
• GenBank Accession Number: BC096241
• Gene Symbol: GABRA6
• Gene ID (NCBI): 2559
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q16445
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Gamma-aminobutyric acid (GABA) is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABAA receptors, which are ligand-gated chloride channels. GABAA receptors are formed by pentameric assembly of 19 different subunit subtypes (α1-α6, β1-β3, γ1-γ3, δ, ɛ, π, θ and ρ1-ρ3) (PMID: 21930603). The mutation R46W of GABRA6 is associated with the pathogenesis of childhood absence epilepsy (CAE) (PMID: 21930603).