Tested Applications
Positive WB detected in | HeLa cells, human heart tissue, rat colon tissue, MCF-7 cells, NIH/3T3 cells |
Positive IP detected in | MCF-7 cells |
Positive IHC detected in | human thyroid cancer tissue, human colon tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | HeLa cells |
Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:5000-1:50000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 26 publications below |
IHC | See 13 publications below |
IF | See 18 publications below |
IP | See 3 publications below |
Product Information
14979-1-AP targets Galectin-3 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, rat, pig |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag6891 Product name: Recombinant human Galectin 3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-250 aa of BC001120 Sequence: MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI Predict reactive species |
Full Name | lectin, galactoside-binding, soluble, 3 |
Calculated Molecular Weight | 26 kDa |
Observed Molecular Weight | 31 kDa |
GenBank Accession Number | BC001120 |
Gene Symbol | Galectin-3 |
Gene ID (NCBI) | 3958 |
RRID | AB_2136768 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P17931 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Galectins are a family of animal lectins defined by shared characteristic amino-acid sequences and affinity for β-galactose-containing oligosac-charides (PMID: 8063692). Galectin-3, a member of the β-galactoside-binding proteins, contains one carbohydrate recognition domain (CRD) and a proline- and glycine-rich N-terminal domain through which is able to form oligomers (PMID: 14758078). Galectin-3 is widely expressed in many normal tissues and a variety of tumors. It is found intracellularly in nucleus and cytoplasm or secreted outside of cell, being present on the cell surface or in the extracellular space (PMID: 16478649). Galectin-3 is involved in various biological processes including cell growth, adhesion, differentiation, apoptosis, angiogenesis, immune response, neoplastic transformation and metastasis (PMID: 16478649; 14758078).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for Galectin-3 antibody 14979-1-AP | Download protocol |
IHC protocol for Galectin-3 antibody 14979-1-AP | Download protocol |
IF protocol for Galectin-3 antibody 14979-1-AP | Download protocol |
IP protocol for Galectin-3 antibody 14979-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Nat Immunol Heme drives hemolysis-induced susceptibility to infection via disruption of phagocyte functions. | ||
Redox Biol Cathepsin C from extracellular histone-induced M1 alveolar macrophages promotes NETosis during lung ischemia-reperfusion injury | ||
Br J Pharmacol Substitution of the SERCA2 Cys(674) reactive thiol accelerates atherosclerosis by inducing endoplasmic reticulum stress and inflammation | ||
J Neuroinflammation Progranulin haploinsufficiency mediates cytoplasmic TDP-43 aggregation with lysosomal abnormalities in human microglia | ||
Acta Pharmacol Sin Modified citrus pectin inhibits breast cancer development in mice by targeting tumor-associated macrophage survival and polarization in hypoxic microenvironment |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Víctor (Verified Customer) (09-18-2024) | The staining appears specific, although there is a bit of background, maybe due to the secondary antibody used. It is quite similar to the staining shown on the product's website
|
FH Tom (Verified Customer) (07-07-2021) | HEK293 whole cell lysates on SDS-PAGE. Antibody incubated with membrane overnight in fridge. HRP secondary antibody used for detection.
![]() |