Tested Applications
Positive IHC detected in | human stomach tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
18143-1-AP targets Gastrin in IHC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag12795 Product name: Recombinant human GAST protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 19-101 aa of BC069724 Sequence: SEASWKPRSQQPDAPLGTGANRDLELPWLEQQGPASHHRRQLGPQGPPHLVADPSKKQGPWLEEEEEAYGWMDFGRRSAEDEN Predict reactive species |
Full Name | gastrin |
Calculated Molecular Weight | 101 aa, 11 kDa |
GenBank Accession Number | BC069724 |
Gene Symbol | Gastrin |
Gene ID (NCBI) | 2520 |
RRID | AB_2878507 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P01350 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Gastrin is a hormone produced primarily by G-cells in the stomach, where it functions to stimulate acid secretion by gastric parietal cells. Gastrin is a promiscuous hormone. Thus, the gastrin gene is expressed in common cancers such as bronchogenic, colorectal, ovarian and pancreatic carcinomas.
Protocols
Product Specific Protocols | |
---|---|
IHC protocol for Gastrin antibody 18143-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |