GBP6 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• GBP6 Polyclonal antibody (23001-1-AP)

GBP6 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 23001-1-AP Copied!

Publications (4)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

EC:3.6.5.-, GBP-6, GTP-binding protein 6, Guanine nucleotide-binding protein 6, Guanylate-binding protein 6

• 

  WB analysis of HeLa using 23001-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 23001-1-AP (GBP6 antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 23001-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 23001-1-AP (GBP6 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 23001-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 23001-1-AP (GBP6 Antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 23001-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 23001-1-AP (GBP6 Antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 23001-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 23001-1-AP (GBP6 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for GBP6 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, MCF-7 cells, Human saliva
• Positive IHC detected in: human testis tissue, human lung cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:5000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

23001-1-AP targets GBP6 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19196

  Product name: Recombinant human GBP6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 530-633 aa of BC131713

  Sequence: LKEKLQMEREHLLREQIMMLEHTQKVQNDWLHEGFKKKYEEMNAEISQFKRMIDTTKNDDTPWIARTLDNLADELTAILSAPAKLIGHGVKGVSSLFKKHKLPF

• Full Name: guanylate binding protein family, member 6
• Calculated Molecular Weight: 633 aa, 72 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC131713
• Gene Symbol: GBP6
• Gene ID (NCBI): 163351
• RRID: AB_2879195
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q6ZN66
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Guanylate-binding protein 6 (GBP6) is a member of the guanylate-binding protein family and is best known as a gene induced by interferon-γ signalling. Interferon-γ is produced predominantly by NK and T-cells, indicating that GBP6 is involved in host immune response (PMID: 28747659, 27029383). GBP6 has 2 isoforms with the molecular mass of 34 and 72 kDa.

Publications

What published studies show

The antibody is anti-GBP6 (Cat# 23001-1-AP), with 4 total citations. Citations appear in Cell Reports, Annals of Medicine, Clinical Oral Investigations, and PLoS One. Research fields include tuberculosis infection and autophagy regulation, esophageal carcinoma prognostic biomarkers, tongue squamous cell carcinoma tumorigenesis, and non-small cell lung cancer ceRNA network analysis.

Automatically generated from the 4 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Cell Rep; Human GBP4 promotes TRIM21-BIP-dependent autophagy to restrict M. tuberculosis infection by preventing SORT1-mediated progranulin degradation.; Authors - Qinglong Guo
		Ann Med; Identification of GBP6 as a potential prognostic biomarker in esophageal carcinoma by integrated bioinformatics analysis and experiment validation; Authors - Shilin Fang
human	WB	Clin Oral Investig; Guanylate-binding protein 6 is a novel biomarker for tumorigenesis and prognosis in tongue squamous cell carcinoma.; Authors - Pei-Feng Liu
human	WB	PLoS One; Construction of ceRNA network to identify the lncRNA and mRNA related to non-small cell lung cancer.; Authors - Kui Xiao