GBP6 Polyclonal antibody

• 

  WB analysis of HeLa using 23001-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 23001-1-AP (GBP6 antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human testis using 23001-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 23001-1-AP (GBP6 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human testis using 23001-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 23001-1-AP (GBP6 Antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human lung cancer using 23001-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 23001-1-AP (GBP6 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

GBP6 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 23001-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

Guanylate-binding protein 6, Guanine nucleotide-binding protein 6, GTP-binding protein 6, GBP-6, EC:3.6.5.-

---

Tested Applications

• Positive WB detected in: HeLa cells, MCF-7 cells
• Positive IHC detected in: human testis tissue, human lung cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:5000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below

Product Information

23001-1-AP targets GBP6 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19196

  Product name: Recombinant human GBP6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 530-633 aa of BC131713

  Sequence: LKEKLQMEREHLLREQIMMLEHTQKVQNDWLHEGFKKKYEEMNAEISQFKRMIDTTKNDDTPWIARTLDNLADELTAILSAPAKLIGHGVKGVSSLFKKHKLPF

• Full Name: guanylate binding protein family, member 6
• Calculated Molecular Weight: 633 aa, 72 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC131713
• Gene Symbol: GBP6
• Gene ID (NCBI): 163351
• RRID: AB_2879195
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q6ZN66
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Guanylate-binding protein 6 (GBP6) is a member of the guanylate-binding protein family and is best known as a gene induced by interferon-γ signalling. Interferon-γ is produced predominantly by NK and T-cells, indicating that GBP6 is involved in host immune response (PMID: 28747659, 27029383). GBP6 has 2 isoforms with the molecular mass of 34 and 72 kDa.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	PLoS One; Construction of ceRNA network to identify the lncRNA and mRNA related to non-small cell lung cancer.; Authors - Kui Xiao
human	WB	Clin Oral Investig; Guanylate-binding protein 6 is a novel biomarker for tumorigenesis and prognosis in tongue squamous cell carcinoma.; Authors - Pei-Feng Liu