GFRA2 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• GFRA2 Recombinant monoclonal antibody (86922-1-RR)

• 

  WB analysis using 86922-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86922-1-RR (GFRA2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

GFRA2 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 86922-1-RR

Clone No.252003B2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

GDNF family receptor alpha 2, GDNF family receptor alpha-2, GDNF receptor alpha 2, GDNF receptor alpha-2, GDNF receptor beta

---

Tested Applications

• Positive WB detected in: L02 cells, HepG2 cells, HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86922-1-RR targets GFRA2 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg4064

  Product name: Recombinant Human GFRA2 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 22-444 aa of BC041688

  Sequence: SPSSLQGPELHGWRPPVDCVRANELCAAESNCSSRYRTLRQCLAGRDRNTMLANKECQAALEVLQESPLYDCRCKRGMKKELQCLQIYWSIHLGLTEGEEFYEASPYEPVTSRLSDIFRLASIFSGTGADPVVSAKSNHCLDAAKACNLNDNCKKLRSSYISICNREISPTERCNRRKCHKALRQFFDRVPSEYTYRMLFCSCQDQACAERRRQTILPSCSYEDKEKPNCLDLRGVCRTDHLCRSRLADFHANCRASYQTVTSCPADNYQACLGSYAGMIGFDMTPNYVDSSPTGIVVSPWCSCRGSGNMEEECEKFLRDFTENPCLRNAIQAFGNGTDVNVSPKGPSFQATQAPRVEKTPSLPDDLSDSTSLGTSVITTCTSVQEQGLKANNSKELSMCFTELTTNIIPGSNKVIKPNSGPS

• Full Name: GDNF family receptor alpha 2
• Calculated Molecular Weight: 464 aa, 52 kDa
• Observed Molecular Weight: 50-55 kDa
• GenBank Accession Number: BC041688
• Gene Symbol: GFRA2
• Gene ID (NCBI): 2675
• RRID: AB_3745206
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O00451
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GFRA2, also named as GDNFRB, RETL2 and TRNR2, belongs to the GDNFR family. It is a receptor for neurturin. GFRA2 mediates the NRTN-induced autophosphorylation and activation of the RET receptor. It is a potent survival factor for central dopaminergic neurons, motor neurons, and several other populations of neurons in the central and peripheral nervous systems. The GDNF signal is mediated by a complex of the receptor tyrosine kinase RET and a glycosylphosphatidylinositol (GPI)-linked protein, GDNFRA. GFRA2 has three isoforms with MW 34-36 kDa, 39-41 kDa and 50-55 kDa. This antibody recognizes 50-55 kDa isoform.