GGA2 Polyclonal antibody, PBS Only

• 

  WB analysis of HeLa using 10356-1-AP (same clone as 10356-1-PBS)

  WB result of GGA2 antibody (10356-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-GGA2 transfected HeLa cells. This data was developed using the same antibody clone with 10356-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 10356-1-AP (same clone as 10356-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 10356-1-AP (GGA2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10356-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human kidney using 10356-1-AP (same clone as 10356-1-PBS)

  human kidney tissue were subjected to SDS PAGE followed by western blot with 10356-1-AP (GGA2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10356-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse adipose using 10356-1-AP (same clone as 10356-1-PBS)

  mouse adipose tissue were subjected to SDS PAGE followed by western blot with 10356-1-AP (GGA2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10356-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 10356-1-AP (same clone as 10356-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 10356-1-AP (GGA2 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10356-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 10356-1-AP (same clone as 10356-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 10356-1-AP (GGA2 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10356-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 10356-1-AP (same clone as 10356-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using GGA2 antibody (10356-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 10356-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

GGA2 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 10356-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

10356-1-PBS targets GGA2 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0370

  Product name: Recombinant human GGA2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 70-316 aa of BC000284

  Sequence: KIQSPQEKEALYALTVLEMCMNHCGEKFHSEVAKFRFLNELIKVLSPKYLGSWATGKVKGRVIEILFSWTVWFPEDIKIRDAYQMLKKQGIIKQDPKLPVDKILPPPSPWPKSSIFDADEEKSKLLTRLLKSNHPEDLQAANRLIKNLVKEEQEKSEKVSKRVSAVEEVRSHVKVLQEMLSMYRRPGQAPPDQEALQVVYERCEKLRPTLFRLASDTTDDDDALAEILQANDLLTQGVLLYKQVMEG

• Full Name: golgi associated, gamma adaptin ear containing, ARF binding protein 2
• Calculated Molecular Weight: 67 kDa
• Observed Molecular Weight: 67 kDa
• GenBank Accession Number: BC000284
• Gene Symbol: GGA2
• Gene ID (NCBI): 23062
• RRID: AB_2110735
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UJY4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GGA2, also known as VEAR, belongs to the GGA protein family and regulates the trafficking of proteins between the trans-Golgi network and the lysosome. GGA2 has an amino-terminal VHS domain in its N terminus which mediates sorting of the mannose 6-phosphate receptors at the trans-Golgi network. They also contain a carboxy-terminal region with homology to the ear domain of gamma-adaptins.