Tested Applications
Positive WB detected in | HT-1080 cells, K-562 cells |
Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
Product Information
28322-1-AP targets GIPR in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag28143 Product name: Recombinant human GIPR protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 401-466 aa of BC093723 Sequence: SEIRRGWHHCRLRRSLGEEQRQLPERAFRALPSGSGPGEVPTSRGLSSGTLPGPGNEASRELESYC Predict reactive species |
Full Name | gastric inhibitory polypeptide receptor |
Calculated Molecular Weight | 466 aa, 53 kDa |
Observed Molecular Weight | 53 kDa |
GenBank Accession Number | BC093723 |
Gene Symbol | GIPR |
Gene ID (NCBI) | 2696 |
RRID | AB_2881113 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P48546 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
GIPR, or Gastric Inhibitory Polypeptide Receptor, plays a crucial role in glucose metabolism and insulin secretion. It is a G protein-coupled receptor (GPCR). It belongs to the B1 class of this receptor family, which is involved in various physiological processes including fat generation, pancreatic beta-cell proliferation, and insulin release.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for GIPR antibody 28322-1-AP | Download protocol |
IHC protocol for GIPR antibody 28322-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |