Tested Applications
| Positive WB detected in | HT-1080 cells, K-562 cells |
| Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 3 publications below |
| IF | See 1 publications below |
Product Information
28322-1-AP targets GIPR in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag28143 Product name: Recombinant human GIPR protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 401-466 aa of BC093723 Sequence: SEIRRGWHHCRLRRSLGEEQRQLPERAFRALPSGSGPGEVPTSRGLSSGTLPGPGNEASRELESYC Predict reactive species |
| Full Name | gastric inhibitory polypeptide receptor |
| Calculated Molecular Weight | 466 aa, 53 kDa |
| Observed Molecular Weight | 53 kDa |
| GenBank Accession Number | BC093723 |
| Gene Symbol | GIPR |
| Gene ID (NCBI) | 2696 |
| RRID | AB_2881113 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P48546 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
GIPR, or Gastric Inhibitory Polypeptide Receptor, plays a crucial role in glucose metabolism and insulin secretion. It is a G protein-coupled receptor (GPCR). It belongs to the B1 class of this receptor family, which is involved in various physiological processes including fat generation, pancreatic beta-cell proliferation, and insulin release.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for GIPR antibody 28322-1-AP | Download protocol |
| WB protocol for GIPR antibody 28322-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Mol Biol Lett The promoting roles of GLP1R and GIPR in stemness maintenance and multiple lineage-specific differentiation of PDLSCs. | ||
Gynecol Endocrinol Glucose-dependent insulinotropic peptide (GIP) suppresses androgen biosynthesis in PCOS mouse models and cellular systems. | ||
PLoS One Gut-derived peptide hormone receptor expression in the developing mouse hypothalamus |









