Use Able AI chat for product recommendations

GIT1 Polyclonal antibody

GIT1 Polyclonal Antibody for WB, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, rat and More (1)

Applications

WB, IF, ELISA

Cool-associated and tyrosine-phosphorylated protein 1, CAT-1, CAT1, CAT 1, ARF GTPase-activating protein GIT1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for GIT1 in ?

Tested Applications

Positive WB detected inROS1728 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

26247-1-AP targets GIT1 in WB, IF, ELISA applications and shows reactivity with human, rat samples.

Tested Reactivity human, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag24648

Product name: Recombinant human GIT1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 471-640 aa of BC067358

Sequence: LRQPPGPVPTPPLPSERAEHTPMAPGGSTHRRDRQAFSMYEPGSALKPFGGPPGDELTTRLQPFHSTELEDDAIYSVHVPAGLYRIRKGVSASAVPFTPSSPLLSCSQEGSRHTSKLSRHGSGADSDYENTQSGDPLLGLEGKRFLELGKEEDFHPELESLDGDLDPGLP

Predict reactive species
Full Name G protein-coupled receptor kinase interacting ArfGAP 1
Calculated Molecular Weight 694 aa, 77 kDa
Observed Molecular Weight80 kDa
GenBank Accession NumberBC067358
Gene Symbol GIT1
Gene ID (NCBI) 28964
RRIDAB_2880445
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9Y2X7
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GIT1 (ARF GTPase-activating protein GIT1) is a member of the GIT subfamily of ADP ribosylation factor (ARF)-GTPase activating protein (GAP) family of proteins, which are characterized by an ARFGAP domain that stimulates the GTPase activity of proteins. GIT1 was highly expressed in the nervous system, and its expression was maintained throughout all brain neuritogenesis stages (PMID: 27127481).

Protocols

Product Specific Protocols
WB protocol for GIT1 antibody 26247-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The GIT1 Polyclonal antibody (Cat# 26247-1-AP) has 3 total citations. These appear in Cancer Letters, Oncogene, and Journal of Cell Biology. The research fields span esophageal squamous cell carcinoma metastasis and chemoresistance, melanoma oncogenesis with invasion and apoptosis suppression, and fibrillar adhesion formation with tensin3 phase separation. Applications cited include WB (human) and IF (mouse).

SpeciesApplicationTitle
humanWB

Cancer Lett

CD24 promotes metastasis and chemoresistance by directly targeting Arf6-ERK pathway in esophageal squamous cell carcinoma.

Authors - Pan Hong

Oncogene

LZTR1 is a melanoma oncogene that promotes invasion and suppresses apoptosis

Authors - Antonella Bacchiocchi
mouseIF

J Cell Biol

Talin-tensin3 interactions regulate fibrillar adhesion formation and tensin3 phase separation.

Authors - Xingchen Li

Reviews

    5.0 out of 5
Add a review

1 verified customer reviews

What customers say

One reviewer (5/5 stars) used this antibody at a 1:1000 dilution for Western Blot on HUVEC cells. They reported detection of the expected band plus an additional band above the expected molecular weight, which was validated by knockdown. The reviewer also confirmed the antibody works well by immunofluorescence, detecting GIT1 at focal adhesions. Overall, the feedback is positive, highlighting reliable performance across both WB and IF applications.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Sammy (Verified Customer) (11-20-2023)

Detects and band above the expected kDa but has been validated by knock down. Antibody also works by immunofluorescence where it detects GIT1 at focal adhesions.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1 in 1000
  • Cell Tissue Type: HUVEC
GIT1 Antibody Western Blot validation (1 in 1000 dilution) in HUVEC (Cat no:26247-1-AP)
Loading...
||
New chat

Able™

正在加载,请稍候...