Tested Applications
| Positive WB detected in | ROS1728 cells | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
26247-1-AP targets GIT1 in WB, ELISA applications and shows reactivity with human, rat samples.
| Tested Reactivity | human, rat | 
| Host / Isotype | Rabbit / IgG | 
| Class | Polyclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag24648 Product name: Recombinant human GIT1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 471-640 aa of BC067358 Sequence: LRQPPGPVPTPPLPSERAEHTPMAPGGSTHRRDRQAFSMYEPGSALKPFGGPPGDELTTRLQPFHSTELEDDAIYSVHVPAGLYRIRKGVSASAVPFTPSSPLLSCSQEGSRHTSKLSRHGSGADSDYENTQSGDPLLGLEGKRFLELGKEEDFHPELESLDGDLDPGLP Predict reactive species | 
                                    
| Full Name | G protein-coupled receptor kinase interacting ArfGAP 1 | 
| Calculated Molecular Weight | 694 aa, 77 kDa | 
| Observed Molecular Weight | 80 kDa | 
| GenBank Accession Number | BC067358 | 
| Gene Symbol | GIT1 | 
| Gene ID (NCBI) | 28964 | 
| RRID | AB_2880445 | 
| Conjugate | Unconjugated | 
| Form | Liquid | 
| Purification Method | Antigen affinity purification | 
| UNIPROT ID | Q9Y2X7 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. | 
Background Information
GIT1 (ARF GTPase-activating protein GIT1) is a member of the GIT subfamily of ADP ribosylation factor (ARF)-GTPase activating protein (GAP) family of proteins, which are characterized by an ARFGAP domain that stimulates the GTPase activity of proteins. GIT1 was highly expressed in the nervous system, and its expression was maintained throughout all brain neuritogenesis stages (PMID: 27127481).
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for GIT1 antibody 26247-1-AP | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Sammy (Verified Customer) (11-20-2023)  | Detects and band above the expected kDa but has been validated by knock down. Antibody also works by immunofluorescence where it detects GIT1 at focal adhesions. 
 ![]()  | 


