• Featured Product
  • KD/KO Validated

GLAST/EAAT1 Polyclonal antibody

GLAST/EAAT1 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Cat No. 20785-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA

EAAT1, GLAST, GLAST-1, SLC1A3, Sodium-dependent glutamate/aspartate transporter 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inNeuro-2a cells, C6 cells, mouse brain tissue
Positive IP detected inmouse brain tissue
Positive IHC detected inmouse brain tissue, rat brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inNeuro-2a cells
Positive FC (Intra) detected inNeuro-2a cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:200-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

20785-1-AP targets GLAST/EAAT1 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, cow
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag14177

Product name: Recombinant human SLC1A3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 471-542 aa of BC037310

Sequence: VDWFLDRLRTTTNVLGDSLGAGIVEHLSRHELKNRDVEMGNSVIEENEMKKPYQLIAQDNETEKPIDSETKM

Predict reactive species
Full Name solute carrier family 1 (glial high affinity glutamate transporter), member 3
Calculated Molecular Weight 542 aa, 60 kDa
Observed Molecular Weight 50-55 kDa, 90-100 kDa
GenBank Accession NumberBC037310
Gene Symbol GLAST
Gene ID (NCBI) 6507
RRIDAB_2878738
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP43003
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SLC1A3, also known as EAAT-1 or GLAST, is a membrane-bound protein localized in glial cells and pre-synaptic glutamatergic nerve endings. It transports the excitatory neurotransmitters L-glutamate and D-aspartate, which is essential for terminating the postsynaptic acction of glutamate. Recently, a correlation between expression/function of glial EAAT-1 and tumor proliferation has been reported. The exceptionally rare expression of EAAT-1 in non-neoplastic choroid plexus (CP) compared to choroid plexus tumors (CPT) may distinguishes neoplastic from normal CP. There are a number of splicing variants of SLC1A3, like GLAST1a and GLAST1b, exist due to the exon skipping. It also undergo glycosylation. Variety of bands can be observed in the western blotting assay: 50-55 kDa represents the unglycosylated GLAST1a or GLAST1b, 65-70 kDa correspond to the glycosylated proteins, larger proteins between 90-130 kDa may be the multimers of SLC1A3. (11086157, 17471058, 12546822)

Protocols

Product Specific Protocols
FC protocol for GLAST/EAAT1 antibody 20785-1-APDownload protocol
IF protocol for GLAST/EAAT1 antibody 20785-1-APDownload protocol
IHC protocol for GLAST/EAAT1 antibody 20785-1-APDownload protocol
IP protocol for GLAST/EAAT1 antibody 20785-1-APDownload protocol
WB protocol for GLAST/EAAT1 antibody 20785-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseIF

Nucleic Acids Res

H2A.Z.1 crosstalk with H3K56-acetylation controls gliogenesis through the transcription of folate receptor.

Authors - Libo Su
mouse

Cell Rep

SOX2 is essential for astrocyte maturation and its deletion leads to hyperactive behavior in mice

Authors - Yan Wang
mouseWB,IF

Cell Death Differ

RNF20 controls astrocytic differentiation through epigenetic regulation of STAT3 in the developing brain.

Authors - Qingli Liang
humanWB

J Neuroimmune Pharmacol

Brain-Derived Exosomal CircRNAs in Plasma Serve as Diagnostic Biomarkers for Acute Ischemic Stroke

Authors - Xinli Jiang
mouseWB

Biochem Pharmacol

Regulatory roles of histamine receptor in astrocytic glutamate clearance under conditions of increased glucose variability

Authors - Yu Zhou
mouseWB

Neuropharmacology

Ginsenoside Rb1 confers neuroprotection via promotion of glutamate transporters in a mouse model of Parkinson's disease.

Authors - Yun-Long Zhang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Christin (Verified Customer) (11-02-2025)

Nice antibody for ICC using human iPSC-derived astrocytes

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: Human iPSC-derived astrocytes
FH

Ryan (Verified Customer) (02-14-2018)

NaCit antigen retrieval ph = 6

  • Applications: Immunohistochemistry,
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: Zebrafish retina and brain at 5dpf
GLAST/EAAT1 Antibody Immunohistochemistry, validation (1:100 dilution) in Zebrafish retina and brain at 5dpf (Cat no:20785-1-AP)
FH

Ryan (Verified Customer) (01-24-2018)

Antigen retrieval - 0.1M Tris-HCl ph9

  • Applications: Immunohistochemistry,
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: Zebrafish retina/brain
GLAST/EAAT1 Antibody Immunohistochemistry, validation (1:100 dilution) in Zebrafish retina/brain (Cat no:20785-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...