GLDN Polyclonal antibody

• 

  WB analysis of human placenta using 26185-1-AP

  human placenta tissue were subjected to SDS PAGE followed by western blot with 26185-1-AP (GLDN Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human brain using 26185-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 26185-1-AP (GLDN Antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human brain using 26185-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 26185-1-AP (GLDN Antibody) at dilution of 1:200 (under 40x lens).

GLDN Polyclonal Antibody for WB, IHC, ELISA

Cat No. 26185-1-AP

Publications(1)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

CLOM, COLM, CRG L2, CRGL2, GLDN, gliomedin, UNC 112

---

Tested Applications

• Positive WB detected in: human placenta tissue
• Positive IHC detected in: human brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IHC: See 1 publications below

Product Information

26185-1-AP targets GLDN in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24247

  Product name: Recombinant human GLDN protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-110 aa of BC113399

  Sequence: MVDLCNSTKGICLTGPSGPPGPPGAGGLPGHNGLDGQPGPQGPKGEKGANGKRGKMGIPGAAGNPGERGEKGDHGELGLQGNEGPPGQKGEKGDKGDVSNDVLLAGAKGD

• Full Name: gliomedin
• Calculated Molecular Weight: 551 aa, 59 kDa
• Observed Molecular Weight: 59 kDa
• GenBank Accession Number: BC113399
• Gene Symbol: GLDN
• Gene ID (NCBI): 342035
• RRID: AB_2880416
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6ZMI3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Genes (Basel); Genome-Wide Association Study Adjusted for Occupational and Environmental Factors for Bladder Cancer Susceptibility.; Authors - Takumi Takeuchi

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Hongxue (Verified Customer) (05-13-2022)

WB with non-specific band

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: Mouse liver

GLDN Antibody Western Blot validation (1:1000 dilution) in Mouse liver (Cat no:26185-1-AP)