Tested Applications
Positive WB detected in | human placenta tissue |
Positive IHC detected in | human brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
IHC | See 1 publications below |
Product Information
26185-1-AP targets GLDN in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag24247 Product name: Recombinant human GLDN protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-110 aa of BC113399 Sequence: MVDLCNSTKGICLTGPSGPPGPPGAGGLPGHNGLDGQPGPQGPKGEKGANGKRGKMGIPGAAGNPGERGEKGDHGELGLQGNEGPPGQKGEKGDKGDVSNDVLLAGAKGD Predict reactive species |
Full Name | gliomedin |
Calculated Molecular Weight | 551 aa, 59 kDa |
Observed Molecular Weight | 59 kDa |
GenBank Accession Number | BC113399 |
Gene Symbol | GLDN |
Gene ID (NCBI) | 342035 |
RRID | AB_2880416 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q6ZMI3 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for GLDN antibody 26185-1-AP | Download protocol |
IHC protocol for GLDN antibody 26185-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Hongxue (Verified Customer) (05-13-2022) | WB with non-specific band
![]() |