Tested Applications
| Positive WB detected in | human placenta tissue |
| Positive IHC detected in | human brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
26185-1-AP targets GLDN in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag24247 Product name: Recombinant human GLDN protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-110 aa of BC113399 Sequence: MVDLCNSTKGICLTGPSGPPGPPGAGGLPGHNGLDGQPGPQGPKGEKGANGKRGKMGIPGAAGNPGERGEKGDHGELGLQGNEGPPGQKGEKGDKGDVSNDVLLAGAKGD Predict reactive species |
| Full Name | gliomedin |
| Calculated Molecular Weight | 551 aa, 59 kDa |
| Observed Molecular Weight | 59 kDa |
| GenBank Accession Number | BC113399 |
| Gene Symbol | GLDN |
| Gene ID (NCBI) | 342035 |
| RRID | AB_2880416 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q6ZMI3 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for GLDN antibody 26185-1-AP | Download protocol |
| WB protocol for GLDN antibody 26185-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The GLDN Polyclonal antibody (Cat# 26185-1-AP) has 1 citation. It was used in a study published in Genes (Basel) (2022) investigating genome-wide association for bladder cancer susceptibility adjusted for occupational and environmental factors. The citation is associated with the research fields of cancer genomics and environmental health, with the antibody applied in IHC on human samples.
| Species | Application | Title |
|---|---|---|
Genes (Basel) Genome-Wide Association Study Adjusted for Occupational and Environmental Factors for Bladder Cancer Susceptibility. |
Reviews
What customers say
One review was submitted for this product. The reviewer used it for Western Blot on mouse liver tissue at a 1:1000 dilution and reported the presence of non-specific bands, rating the product 3 out of 5.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Hongxue (Verified Customer) (05-13-2022) | WB with non-specific band
 |
