Tested Applications
Positive WB detected in | HeLa cells, A549 cells, MCF-7 cells, PC-3 cells, HepG2 cells, Jurkat cells |
Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
26466-1-AP targets GLE1 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag24208 Product name: Recombinant human GLE1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-118 aa of BC030012 Sequence: MPSEGRCWETLKALRSSDKGRLCYYRDWLLRREDVLEECMSLPKLSSYSGWVVEHVLPHMQENQPLSETSPSSTSASALDQPSFVPKSPDASSAFSPASPATPNGTKGKDESQHTESM Predict reactive species |
Full Name | GLE1 RNA export mediator homolog (yeast) |
Calculated Molecular Weight | 80 kDa |
Observed Molecular Weight | 79-80 kDa |
GenBank Accession Number | BC030012 |
Gene Symbol | GLE1 |
Gene ID (NCBI) | 2733 |
RRID | AB_2880525 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q53GS7 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
IF protocol for GLE1 antibody 26466-1-AP | Download protocol |
WB protocol for GLE1 antibody 26466-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Rashmi (Verified Customer) (09-25-2024) | Excellent Product
|