GLE1 Polyclonal antibody

• 

  WB analysis using 26466-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26466-1-AP (GLE1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A549 using 26466-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 26466-1-AP (GLE1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of MCF-7 using 26466-1-AP

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 26466-1-AP (GLE1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of PC-3 using 26466-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 26466-1-AP (GLE1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HepG2 using 26466-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using 26466-1-AP (GLE1 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

GLE1 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 26466-1-AP

Publications(1)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

GLE1, GLE1 like protein, GLE1L, hGLE1, LCCS, LCCS1, Nucleoporin GLE1

---

Tested Applications

• Positive WB detected in: HeLa cells, A549 cells, MCF-7 cells, PC-3 cells, HepG2 cells, Jurkat cells
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IF: See 1 publications below

Product Information

26466-1-AP targets GLE1 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24208

  Product name: Recombinant human GLE1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-118 aa of BC030012

  Sequence: MPSEGRCWETLKALRSSDKGRLCYYRDWLLRREDVLEECMSLPKLSSYSGWVVEHVLPHMQENQPLSETSPSSTSASALDQPSFVPKSPDASSAFSPASPATPNGTKGKDESQHTESM

• Full Name: GLE1 RNA export mediator homolog (yeast)
• Calculated Molecular Weight: 80 kDa
• Observed Molecular Weight: 79-80 kDa
• GenBank Accession Number: BC030012
• Gene Symbol: GLE1
• Gene ID (NCBI): 2733
• RRID: AB_2880525
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q53GS7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	J Inflamm Res; An Integrated Machine Learning Framework for Developing and Validating a Diagnostic Model of Hub Genes Related to Lipid Metabolism in Chronic Rhinosinusitis; Authors - Panhui Xiong

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Rashmi (Verified Customer) (09-25-2024)

Excellent Product

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: HEK293T