Product Information
67026-1-PBS targets GLUD1 in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag6179 Product name: Recombinant human GLUD1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 214-558 aa of BC040132 Sequence: FIGPGIDVPAPDMSTGEREMSWIADTYASTIGHYDINAHACVTGKPISQGGIHGRISATGRGVFHGIENFINEASYMSILGMTPGFGDKTFVVQGFGNVGLHSMRYLHRFGAKCIAVGESDGSIWNPDGIDPKELEDFKLQHGSILGFPKAKPYEGSILEADCDILIPAASEKQLTKSNAPRVKAKIIAEGANGPTTPEADKIFLERNIMVIPDLYLNAGGVTVSYFEWLKNLNHVSYGRLTFKYERDSNYHLLMSVQESLERKFGKHGGTIPIVPTAEFQDRISGASEKDIVHSGLAYTMERSARQIMRTAMKYNLGLDLRTAAYVNAIEKVFKVYNEAGVTFT Predict reactive species |
| Full Name | glutamate dehydrogenase 1 |
| Calculated Molecular Weight | 61 kDa |
| Observed Molecular Weight | 45-55 kDa |
| GenBank Accession Number | BC040132 |
| Gene Symbol | GLUD1 |
| Gene ID (NCBI) | 2746 |
| RRID | AB_2882341 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P00367 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
Human glutamate dehydrogenase (GDH), an enzyme central to the metabolism of glutamate, is known to exist in housekeeping and nerve tissue-specific isoforms encoded by the GLUD1 and GLUD2 genes, respectively. It catalyses the reversible inter-conversion of glutamate to alpha-ketoglutarate and ammonia, thus interconnecting amino acid and carbohydrate metabolism. GLUD1 might contribute to the formation of specific synapses in the hippocampus such as those formed by the projecting neurons of the entorhinal cortex(PMID: 22138648). GLUD1 has a calculated molecular mass of 61 kDa and an apparent molecular mass of 45-55 kDa with the 53aa transit peptide removed.

















