• Featured Product
  • KD/KO Validated

Glutamine Synthetase Polyclonal antibody

Glutamine Synthetase Polyclonal Antibody for WB, IHC, IF-P, FC (Intra), IP, ELISA
Cat No. 11037-2-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, FC (Intra), IP, ELISA

GLUL, EC:2.3.1.225, EC:6.3.1.2, GLNS, Glutamate--ammonia ligase

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, Jurkat cells, mouse liver tissue, rat liver tissue
Positive IP detected inmouse liver tissue
Positive IHC detected inmouse liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse liver tissue, human brain tissue, mouse eye tissue
Positive FC (Intra) detected inJurkat cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:16000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11037-2-AP targets Glutamine Synthetase in WB, IHC, IF-P, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1510

Product name: Recombinant human Glutamine synthetase protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-373 aa of BC011700

Sequence: MTTSASSHLNKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEWNFDGSSTLQSEGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPCEGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETGDEPFQYKN

Predict reactive species
Full Name glutamate-ammonia ligase (glutamine synthetase)
Calculated Molecular Weight 374 aa, 42 kDa
Observed Molecular Weight 40-42 kDa
GenBank Accession NumberBC011700
Gene Symbol Glutamine Synthetase
Gene ID (NCBI) 2752
RRIDAB_2110650
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP15104
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GLUL(Glutamine synthetase) is also named as GS,GLNS and belongs to the glutamine synthetase family.This enzyme has 2 functions: it catalyzes the production of glutamine and 4-aminobutanoate (gamma-aminobutyric acid, GABA), the latter in a pyridoxal phosphate-independent manner By similarity. Essential for proliferation of fetal skin fibroblasts(PMID:18662667).Defects in GLUL are the cause of congenital systemic glutamine deficiency (CSGD).Organismal glutamine production is augmented secondary to an increase in the activity of glutamine synthetase in the lung and skeletal muscle(PMID:7630137). There are other bands with higher (66 kDa, 97 kDa) and lower (30 kDa)molecular weights also detected besides the 42 kDa band indicating the proteolysis of GLUL protein by the ubiquitin system(PMID:10091759).

Protocols

Product Specific Protocols
WB protocol for Glutamine Synthetase antibody 11037-2-APDownload protocol
IHC protocol for Glutamine Synthetase antibody 11037-2-APDownload protocol
IF protocol for Glutamine Synthetase antibody 11037-2-APDownload protocol
IP protocol for Glutamine Synthetase antibody 11037-2-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseIF

Nat Methods

Spatially resolved isotope tracing reveals tissue metabolic activity.

Authors - Lin Wang
mouseWB

Cell Metab

Acetate enables metabolic fitness and cognitive performance during sleep disruption

Authors - Qinqin He
mouseWB,IHC

Cell Metab

High dietary fructose promotes hepatocellular carcinoma progression by enhancing O-GlcNAcylation via microbiota-derived acetate

Authors - Peng Zhou
  • KD Validated
mouse,humanWB,IF

Protein Cell

Follicle stimulating hormone controls granulosa cell glutamine synthesis to regulate ovulation

Authors - Kai-Hui Zhang
humanWB

Sci Transl Med

An extracorporeal bioartificial liver embedded with 3D-layered human liver progenitor-like cells relieves acute liver failure in pigs.

Authors - Wei-Jian Li
mouseWB

Cell Res

Glutaminase GLS1 senses glutamine availability in a non-enzymatic manner triggering mitochondrial fusion.

Authors - Wei-Feng Cai
  • KD Validated

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Marisa (Verified Customer) (07-29-2025)

I've used this antibody for immunohistochemistry in brain slices followed by confocal microscopy, and it performed consistently well. Clear signal, minimal background, and good lot-to-lot consistency. The datasheet and customer support were also helpful. Highly recommend for confocal applications.

  • Applications: Immunohistochemistry
  • Primary Antibody Dilution: 1-250
  • Cell Tissue Type: Brain
FH

Andrea (Verified Customer) (09-06-2023)

antibody works perfect

  • Applications: Immunohistochemistry
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: mouse retina
FH

Melanie (Verified Customer) (02-02-2023)

Good antibody, which works well in HEK293T cells

  • Applications: Western Blot
  • Cell Tissue Type: HEK293T cells
FH

Ryan (Verified Customer) (02-27-2019)

Tris-HCL antigen retrieval ph=9.

  • Applications: Immunohistochemistry, Immunofluorescence,
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: Zebrafish retina (Muller glia) at 3dpf
Glutamine Synthetase Antibody Immunohistochemistry,Immunofluorescence, validation (1:100 dilution) in Zebrafish retina (Muller glia) at 3dpf (Cat no:11037-2-AP)
Loading...
||
New chat Able
正在加载,请稍候...